PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof020014

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

NAC

Protein Properties

Length: 125aa MW: 14275.3 Da PI: 10.5234

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Sof#S17332919	PU_ref	Unigene	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	113	3.1e-35	8	96	38	128
NAM 38 diykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++yk++Pw+Lp+k++++ekewyfFs+rd+ky++g+r+nra+ +gyWka+g dk+v s + v +kk Lvfy+g+ pkg+kt+W+mheyrl Sof020014 8 HLYKFDPWQLPEKAYGGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKASGADKPVGS--PRPVAIKKALVFYSGKPPKGVKTNWIMHEYRL 96 79*******999999**********************************99..779*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	39.221	1	121	IPR003441	NAC domain
SuperFamily	SSF101941	8.37E-38	8	102	IPR003441	NAC domain
Pfam	PF02365	6.7E-15	18	96	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 125 aa Download sequence Send to blast
MDCGGALHLY KFDPWQLPEK AYGGEKEWYF FSPRDRKYPN GSRPNRAAGT GYWKASGADK 60 PVGSPRPVAI KKALVFYSGK PPKGVKTNWI MHEYRLADVD RSAAARKKTN NSLRICQEHS 120 RMKVW

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-45	7	120	52	167	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-45	7	120	52	167	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-45	7	120	52	167	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-45	7	120	52	167	NO APICAL MERISTEM PROTEIN
3swm_A	2e-45	1	120	49	170	NAC domain-containing protein 19
3swm_B	2e-45	1	120	49	170	NAC domain-containing protein 19
3swm_C	2e-45	1	120	49	170	NAC domain-containing protein 19
3swm_D	2e-45	1	120	49	170	NAC domain-containing protein 19
3swp_A	2e-45	1	120	49	170	NAC domain-containing protein 19
3swp_B	2e-45	1	120	49	170	NAC domain-containing protein 19
3swp_C	2e-45	1	120	49	170	NAC domain-containing protein 19
3swp_D	2e-45	1	120	49	170	NAC domain-containing protein 19
4dul_A	2e-45	7	120	52	167	NAC domain-containing protein 19
4dul_B	2e-45	7	120	52	167	NAC domain-containing protein 19
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.21317	0.0	callus\| root\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots and embryo. Weakly expressed in callus. {ECO:0000269\|PubMed:10660065}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses. {ECO:0000269\|PubMed:20632034}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by dehydration, salt stress, cold stress, abscisic acid (ABA) and methyl jasmonate. {ECO:0000269\|PubMed:20632034}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001308992.1	1e-68	uncharacterized protein LOC100384376
Refseq	XP_002450434.1	1e-68	NAC domain-containing protein 71
Swissprot	Q53NF7	8e-62	NAC71_ORYSJ; NAC domain-containing protein 71
TrEMBL	A0A1X7YEW9	3e-69	A0A1X7YEW9_MAIZE; Uncharacterized protein
TrEMBL	C0PNU1	4e-69	C0PNU1_MAIZE; Uncharacterized protein
STRING	Sb05g005450.1	6e-68	(Sorghum bicolor)
STRING	GRMZM2G123667_P02	5e-68	(Zea mays)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	2e-59	NAC domain containing protein 32

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Sperotto RA, et al. Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. J. Plant Physiol., 2010. 167(17): p. 1500-6 [PMID:20580124] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kan CC,Chung TY,Juo YA,Hsieh MH Glutamine rapidly induces the expression of key transcription factor genes involved in nitrogen and stress responses in rice roots. BMC Genomics, 2015. 16(1): p. 731 [PMID:26407850]