PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof020272

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

WRKY

Protein Properties

Length: 116aa MW: 13047.2 Da PI: 9.9104

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Saccharum_officinarum-86902	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	109.1	2.1e-34	7	65	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg+++p+sYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe Sof020272 7 LDDGYRWRKYGQKVVKGNPHPKSYYKCTFAGCNVRKHIERASSDPKAVITTYEGKHNHE 65 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	36.185	2	67	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	3.6E-34	3	67	IPR003657	WRKY domain
SuperFamily	SSF118290	6.28E-29	4	67	IPR003657	WRKY domain
SMART	SM00774	9.4E-39	7	66	IPR003657	WRKY domain
Pfam	PF03106	1.8E-26	8	65	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
XREDDLLDDG YRWRKYGQKV VKGNPHPKSY YKCTFAGCNV RKHIERASSD PKAVITTYEG 60 KHNHEPPVGR GSNQNAGISQ QKGQNNISSN QASLPRPDFS NANQMPLGIL QFKSEQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	5e-37	3	67	13	77	Probable WRKY transcription factor 4
2lex_A	5e-37	3	67	13	77	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Sof.18720	0.0	crown\| leaf\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269\|PubMed:11722756}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:11722756}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002442198.1	2e-75	probable WRKY transcription factor 3
Swissprot	Q9ZQ70	1e-35	WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBL	C5YP19	4e-74	C5YP19_SORBI; Uncharacterized protein
STRING	Sb08g016240.1	7e-75	(Sorghum bicolor)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03340.1	4e-38	WRKY DNA-binding protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Aamir M, et al. Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach. Front Plant Sci, 2017. 8: p. 819 [PMID:28611792]