PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sof020287

Organism

Saccharum officinarum

Taxonomic ID

4547

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex

Family

HSF

Protein Properties

Length: 115aa MW: 12675.1 Da PI: 4.7784

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PUT-157a-Saccharum_officinarum-124509	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	69.6	6.6e-22	46	102	2	58
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLn 58 Fl+k+++++ed++++ ++sws+ gnsfvv+d++ fa+ +Lp+ Fkh+nf+SFvRQL Sof020287 46 FLTKTFDLVEDPATDAVVSWSRAGNSFVVWDPHVFADAMLPRLFKHNNFSSFVRQLT 102 9******************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.0E-24	39	102	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	9.5E-18	42	111	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.25E-20	44	102	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	1.9E-19	46	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-12	46	69	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-12	84	96	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.1E-12	97	109	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 115 aa Download sequence Send to blast
MDPSVAPGIV KEELLEQHQP MQDGVGGGGA APRPMEGLHE VGPPPFLTKT FDLVEDPATD 60 AVVSWSRAGN SFVVWDPHVF ADAMLPRLFK HNNFSSFVRQ LTPIYMEQHT GWSTX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-17	25	102	16	85	Heat shock factor protein 1
5d5v_B	1e-17	25	102	16	85	Heat shock factor protein 1
5d5v_D	1e-17	25	102	16	85	Heat shock factor protein 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves and immature seeds. {ECO:0000269\|PubMed:16202242}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:16202242}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002467215.1	1e-63	heat stress transcription factor A-2c
Swissprot	Q338B0	2e-52	HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBL	C5X1F4	3e-62	C5X1F4_SORBI; Uncharacterized protein
STRING	Sb01g021490.1	4e-63	(Sorghum bicolor)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G22830.1	1e-35	heat shock transcription factor A6B

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Singh A, et al. OsHsfA2c and OsHsfB4b are involved in the transcriptional regulation of cytoplasmic OsClpB (Hsp100) gene in rice (Oryza sativa L.). Cell Stress Chaperones, 2012. 17(2): p. 243-54 [PMID:22147560]