![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc01g009650.1.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 92aa MW: 10497.2 Da PI: 10.4395 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 46.4 | 9.3e-15 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++ Ed++l+d++ ++G +W++++ g+ Rt+k+c++rw +yl
Solyc01g009650.1.1 17 KGLWSPYEDQKLKDYILKHGHVCWASVPINAGLQRTGKSCRLRWINYL 64
678*****************99************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-22 | 12 | 67 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 22.173 | 12 | 68 | IPR017930 | Myb domain |
| SMART | SM00717 | 5.3E-10 | 16 | 66 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.3E-13 | 17 | 64 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.19E-18 | 19 | 91 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.17E-9 | 20 | 64 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-6 | 68 | 91 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MGCKQIDKSK PKQKHKKGLW SPYEDQKLKD YILKHGHVCW ASVPINAGLQ RTGKSCRLRW 60 INYLRPGLKR GTFSTDEEEA ILTFHGMLGN K* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed at very low level. Expressed in cauline leaves. {ECO:0000269|PubMed:11581165}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc01g009650.1.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AF426174 | 1e-07 | Lycopersicon esculentum blind mRNA, complete cds | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004228860.1 | 2e-62 | transcription factor LAF1-like | ||||
| Swissprot | Q9M0K4 | 4e-38 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A2G3DGB1 | 4e-52 | A0A2G3DGB1_CAPCH; Transcription factor MYB86 | ||||
| STRING | Solyc01g009650.1.1 | 1e-62 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G25560.1 | 2e-40 | myb domain protein 18 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc01g009650.1.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




