PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc01g067130.2.1

Common Name

LOC101249009

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

NF-YB

Protein Properties

Length: 139aa MW: 15010.6 Da PI: 5.9617

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc01g067130.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	168.2	9.8e-53	22	117	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 reqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+easdkc++e+rkt+ngdd++wal+tlGf+dy +lk yl++yre Solyc01g067130.2.1 22 REQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTVNGDDICWALGTLGFDDYSGALKRYLHRYRE 112 89*************************************************************************************** PP NF-YB 93 legek 97 egek Solyc01g067130.2.1 113 SEGEK 117 997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.2E-49	18	123	IPR009072	Histone-fold
SuperFamily	SSF47113	1.23E-37	24	122	IPR009072	Histone-fold
Pfam	PF00808	1.4E-26	27	91	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.4E-15	55	73	No hit	No description
PRINTS	PR00615	1.4E-15	74	92	No hit	No description
PRINTS	PR00615	1.4E-15	93	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MSQQNIGGAS SSNDEGAAGS SREQDRLLPI ANVGRIMKNI LPPNAKISKE AKETMQECVS 60 EFIGFVTGEA SDKCRKERRK TVNGDDICWA LGTLGFDDYS GALKRYLHRY RESEGEKVNQ 120 EQAGGGASGS NQPRNLLD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-43	22	112	2	92	Transcription factor HapC (Eurofung)
4g92_B	2e-43	22	112	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc01g067130.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019068761.1	6e-99	nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	2e-60	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A3Q7EG93	1e-97	A0A3Q7EG93_SOLLC; Uncharacterized protein
STRING	Solyc01g067130.2.1	2e-98	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	9e-63	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Solyc01g067130.2.1
Entrez Gene	101249009

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]