![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc01g087990.2.1 | ||||||||
| Common Name | LOC101260573 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 272aa MW: 30847 Da PI: 6.0061 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 88 | 5.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k ien nrqvtfskRr+g+lKKA ELSvLCd evaviifsstgkl+e+ss
Solyc01g087990.2.1 9 KLIENLNNRQVTFSKRRAGLLKKAGELSVLCDSEVAVIIFSSTGKLFEFSS 59
569**********************************************96 PP
| |||||||
| 2 | K-box | 57.4 | 6.4e-20 | 95 | 186 | 9 | 100 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
++++ ++ q+e++ Lk+e+ +L+ +q +llG+dL+ + l+eL+ Le+qL+++l i+++K+ell++q+e+++k+e++ e ++Lr+++e
Solyc01g087990.2.1 95 QQTHVLKQEQKEVDSLKDELAKLKMKQQRLLGKDLNGMGLNELRLLEHQLNEGLLAIKERKEELLIQQLEYSRKQEERSALECETLRRQVE 185
4444568899*******************************************************************************98 PP
K-box 100 e 100
e
Solyc01g087990.2.1 186 E 186
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.314 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.53E-31 | 2 | 74 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 7.05E-40 | 2 | 75 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.8E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-24 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.8E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.8E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.6E-14 | 96 | 184 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.508 | 100 | 190 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010047 | Biological Process | fruit dehiscence | ||||
| GO:0010262 | Biological Process | somatic embryogenesis | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0048577 | Biological Process | negative regulation of short-day photoperiodism, flowering | ||||
| GO:0060862 | Biological Process | negative regulation of floral organ abscission | ||||
| GO:0060867 | Biological Process | fruit abscission | ||||
| GO:0071365 | Biological Process | cellular response to auxin stimulus | ||||
| GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 272 aa Download sequence Send to blast |
MGRGKIDIKL IENLNNRQVT FSKRRAGLLK KAGELSVLCD SEVAVIIFSS TGKLFEFSST 60 SMKQTLSRYN KCVASTDNSA VEKKSEDNEQ PQLQQQTHVL KQEQKEVDSL KDELAKLKMK 120 QQRLLGKDLN GMGLNELRLL EHQLNEGLLA IKERKEELLI QQLEYSRKQE ERSALECETL 180 RRQVEELRGL FPLSASLPPP FLEYDRPLEK KYSILKESKE SLDSDTACED GVDDEDSNTT 240 LQLGLPTICR KRKRTEQESP SSNSENQVGS K* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 2e-21 | 1 | 69 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Les.17676 | 0.0 | fruit | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Accumulates before fertilization in the cytoplasm in the cells of the egg apparatus and moves into the nucleus during early stages of development following fertilization in the suspensor, embryo, and endosperm, mainly double fertilization derived tissues (at protein level). Highly expressed in developing embryos. In young seedlings, present in the shoot and root apices, lateral root primordia and throughout the vascular system. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed at low levels in flowers and siliques. Also present in seedlings. Detected during embryogenesis and accumulates during early seed development (at protein level). Expressed in shoot apices and the base of leaf petioles. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:8953767}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00508 | DAP | Transfer from AT5G13790 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc01g087990.2.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT014220 | 0.0 | Lycopersicon esculentum clone 133400R, mRNA sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004229674.1 | 0.0 | agamous-like MADS-box protein AGL15 isoform X2 | ||||
| Swissprot | Q38847 | 2e-68 | AGL15_ARATH; Agamous-like MADS-box protein AGL15 | ||||
| TrEMBL | A0A3Q7F370 | 0.0 | A0A3Q7F370_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc01g087990.2.1 | 0.0 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA8775 | 22 | 26 | Representative plant | OGRP16 | 17 | 761 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 2e-64 | AGAMOUS-like 15 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc01g087990.2.1 |
| Entrez Gene | 101260573 |




