![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc01g099320.2.1 | ||||||||
| Common Name | LOC101267361 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 147aa MW: 16727.8 Da PI: 4.9004 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 147.8 | 2.2e-46 | 4 | 96 | 3 | 95 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
e+ +++Pianv+rimk++lP akisk+aket+qec+sefisfvt+easdkc++e+r+t+ngdd++wal++lGf++y+e + yl k r++e+
Solyc01g099320.2.1 4 EHVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFER 96
566899*************************************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.6E-43 | 6 | 120 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.37E-34 | 9 | 117 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-26 | 9 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.3E-17 | 36 | 54 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 39 | 55 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.3E-17 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 5.3E-17 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MVDEHVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCHKENR 60 RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERVRAN QNKLGLNDDD NTDDDDDDGE 120 ARRASTTSLA PLEINVMERV QRRRFN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 8e-37 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 8e-37 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc01g099320.2.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC193777 | 0.0 | Solanum lycopersicum chromosome 1 clone C01HBa0051C14, complete sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004231278.1 | 1e-106 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 2e-49 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A2G2W7T3 | 3e-80 | A0A2G2W7T3_CAPBA; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A3Q7END4 | 2e-80 | A0A3Q7END4_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc01g099320.2.1 | 1e-105 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 7e-51 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc01g099320.2.1 |
| Entrez Gene | 101267361 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




