![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc02g065800.1.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 143aa MW: 16204.5 Da PI: 9.6825 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 98.4 | 1.3e-30 | 43 | 111 | 2 | 70 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
g+kdrhsk+ T +g+RdRRvRls+++a +++dLqd+LG+d++sk ++WLl++ak+ i+el+ ++ ++
Solyc02g065800.1.1 43 FGGKDRHSKVLTVKGLRDRRVRLSVPTALQVYDLQDKLGLDQPSKVVDWLLNEAKHDIDELPPLQIRDQ 111
689***********************************************************9955444 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 29.99 | 45 | 103 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 2.4E-29 | 45 | 130 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MISREVDPSD NNVIMIPKKS SLSSSSSWTR FKDPRIVRVS RAFGGKDRHS KVLTVKGLRD 60 RRVRLSVPTA LQVYDLQDKL GLDQPSKVVD WLLNEAKHDI DELPPLQIRD QTGLPLTGLR 120 KEEEETMVVS DEDRVKLDVR NT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 1e-19 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
| 5zkt_B | 1e-19 | 50 | 104 | 1 | 55 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc02g065800.1.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC246813 | 0.0 | Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-33h20 map 2, complete sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004253504.3 | 5e-97 | transcription factor TCP17-like | ||||
| Swissprot | Q9S7W5 | 2e-40 | TCP13_ARATH; Transcription factor TCP13 | ||||
| TrEMBL | A0A494GA56 | 1e-95 | A0A494GA56_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc02g065800.1.1 | 4e-97 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA821 | 24 | 99 | Representative plant | OGRP180 | 15 | 163 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02150.1 | 7e-43 | plastid transcription factor 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc02g065800.1.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




