![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc02g067330.1.1 | ||||||||
| Common Name | LOC101253753 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 103aa MW: 11208.4 Da PI: 6.6537 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 106.9 | 1.2e-33 | 30 | 85 | 4 | 60 |
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
vrYkeC+kNhAa++GghavDGC+Efmps geegt++a+ CaACgCHRnFHRreve+e
Solyc02g067330.1.1 30 VRYKECQKNHAARVGGHAVDGCREFMPS-GEEGTSSAFICAACGCHRNFHRREVETE 85
89*************************9.999*********************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 1.0E-22 | 25 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 3.8E-31 | 30 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 2.4E-28 | 31 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.909 | 32 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MRKIQLFENQ DDESVTSESS TNSAFTVRIV RYKECQKNHA ARVGGHAVDG CREFMPSGEE 60 GTSSAFICAA CGCHRNFHRR EVETEVASHS LSSSSSSSCV LF* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc02g067330.1.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC122544 | 5e-10 | Genomic sequence for Lycopersicon esculentum, clone L136C6, complete sequence | |||
| GenBank | AC226507 | 5e-10 | Solanum lycopersicum chromosome 2 clone C02HBa0136C06, complete sequence | |||
| GenBank | AM261628 | 5e-10 | Solanum lycopersicum mRNA for mini zinc finger protein (ima gene) | |||
| GenBank | EU161283 | 5e-10 | Solanum lycopersicum clone BAC L136C6 transcription factor style2.1 gene, complete cds | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004233925.1 | 3e-69 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 5e-30 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A3Q7F010 | 2e-51 | A0A3Q7F010_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc02g067330.1.1 | 1e-68 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 | Representative plant | OGRP91 | 16 | 237 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 1e-31 | mini zinc finger 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc02g067330.1.1 |
| Entrez Gene | 101253753 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




