![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc02g084420.2.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | DBB | ||||||||
| Protein Properties | Length: 89aa MW: 9572.16 Da PI: 5.5724 | ||||||||
| Description | DBB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-B_box | 26.1 | 1.8e-08 | 4 | 33 | 5 | 34 |
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeH 34
C+ +e+ ++lfC ++ lC+ C ++ H
Solyc02g084420.2.1 4 LCDVCESAAAILFCAADEAALCRACDEKVH 33
7**************************999 PP
| |||||||
| 2 | zf-B_box | 28.7 | 2.8e-09 | 52 | 84 | 2 | 34 |
zf-B_box 2 eerkCpeHeekelqlfCedCqqllCedClleeH 34
e ++C+ +e+ ++ ++Ce +++ lC +C + H
Solyc02g084420.2.1 52 EVPRCDICENSPAFFYCEVDGSSLCLQCDMMVH 84
789**************************9888 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00336 | 1.3E-8 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| PROSITE profile | PS50119 | 10.139 | 1 | 47 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 3.40E-5 | 3 | 45 | No hit | No description |
| Pfam | PF00643 | 7.4E-7 | 3 | 42 | IPR000315 | B-box-type zinc finger |
| SuperFamily | SSF57845 | 6.64E-5 | 48 | 85 | No hit | No description |
| PROSITE profile | PS50119 | 9.129 | 51 | 88 | IPR000315 | B-box-type zinc finger |
| SMART | SM00336 | 2.9E-4 | 51 | 88 | IPR000315 | B-box-type zinc finger |
| Pfam | PF00643 | 1.1E-7 | 51 | 84 | IPR000315 | B-box-type zinc finger |
| CDD | cd00021 | 1.70E-5 | 54 | 84 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000989 | Molecular Function | transcription factor activity, transcription factor binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MRTLCDVCES AAAILFCAAD EAALCRACDE KVHMCNKLAS RHVRVGIAKP NEVPRCDICE 60 NSPAFFYCEV DGSSLCLQCD MMVHVGGK* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Les.1219 | 1e-148 | fruit| leaf | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Acts as negative regulator of seedling photomorphogenesis. {ECO:0000269|PubMed:18540109}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc02g084420.2.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC232776 | 8e-49 | Solanum lycopersicum chromosome 2 clone C02SLm0132H19, complete sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015066178.1 | 4e-59 | B-box zinc finger protein 19-like | ||||
| Swissprot | C0SVM5 | 3e-50 | BBX19_ARATH; B-box zinc finger protein 19 | ||||
| TrEMBL | A0A3Q7F718 | 2e-57 | A0A3Q7F718_SOLLC; Uncharacterized protein | ||||
| TrEMBL | M0ZW20 | 3e-56 | M0ZW20_SOLTU; B-box zinc finger protein 23 | ||||
| STRING | Solyc02g084420.2.1 | 4e-58 | (Solanum lycopersicum) | ||||
| STRING | PGSC0003DMT400009328 | 4e-57 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3175 | 23 | 40 | Representative plant | OGRP3352 | 16 | 28 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G38960.1 | 1e-52 | DBB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc02g084420.2.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




