PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc02g094290.1.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

TCP

Protein Properties

Length: 114aa MW: 13079.1 Da PI: 11.1393

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc02g094290.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	120.7	1.7e-37	31	99	2	70
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlq+a+p+i+++tg ++++a Solyc02g094290.1.1 31 APKRKSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQKAEPSIIAATGHGTIQA 99 789*************************************************************98887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	2.5E-30	36	100	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	27.985	37	91	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
MKRQNTNNTM EMKDFQIGIA EKDEAKKHQL APKRKSNKDR HTKVEGRGRR IRMPALCAAR 60 IFQLTRELGH KSDGETIQWL LQKAEPSIIA ATGHGTIQAS LYRRLDPLFR NRE*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.24646	1e-178	fruit\| leaf

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269\|PubMed:12631321, ECO:0000269\|PubMed:16123132}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc02g094290.1.1

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC215457	0.0	Solanum lycopersicum chromosome 2 clone C02SLe0061K08, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025885512.1	3e-67	LOW QUALITY PROTEIN: transcription factor TCP20
Swissprot	Q9LSD5	6e-45	TCP20_ARATH; Transcription factor TCP20
TrEMBL	A0A3Q7FEE8	1e-78	A0A3Q7FEE8_SOLLC; Uncharacterized protein
STRING	Solyc02g094290.1.1	2e-79	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA248	24	201
Representative plant	OGRP922	14	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27010.1	3e-47	TCP family protein

Link Out ? help Back to Top
Phytozome	Solyc02g094290.1.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Zhu P, et al. Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972 [PMID:27708161] Wu JF, et al. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis. Nat Commun, 2016. 7: p. 13181 [PMID:27734958] Guan P, et al. Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] Guan P Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis. Front Plant Sci, 2017. 8: p. 1697 [PMID:29033968] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375] Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692]