PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g061620.1.1
Common NameLOC101260998
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 89aa    MW: 9648.53 Da    PI: 6.0824
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g061620.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.47e-332379360
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                        +vrY+eC++NhAa +Gg+avDGC+Efmps geegt+ al CaACgCHRnF Rreve+e
  Solyc03g061620.1.1 23 TVRYRECQRNHAAGVGGYAVDGCREFMPS-GEEGTPGALSCAACGCHRNFRRREVETE 79
                        79**************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-251987IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.4E-302476IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.9E-272576IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.2572675IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MTKRHEDDEE NDGSLHTSIT IRTVRYRECQ RNHAAGVGGY AVDGCREFMP SGEEGTPGAL  60
SCAACGCHRN FRRREVETEV ASNCSSPS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc03g061620.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1225443e-14Genomic sequence for Lycopersicon esculentum, clone L136C6, complete sequence
GenBankAC2265073e-14Solanum lycopersicum chromosome 2 clone C02HBa0136C06, complete sequence
GenBankAM2616283e-14Solanum lycopersicum mRNA for mini zinc finger protein (ima gene)
GenBankEU1612833e-14Solanum lycopersicum clone BAC L136C6 transcription factor style2.1 gene, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004234800.12e-59mini zinc finger protein 2-like
SwissprotQ9LJW51e-32MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A3Q7FIA84e-58A0A3Q7FIA8_SOLLC; Uncharacterized protein
STRINGSolyc03g061620.1.17e-59(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.16e-35mini zinc finger 2
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]