PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc03g061620.1.1

Common Name

LOC101260998

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9648.53 Da PI: 6.0824

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc03g061620.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	104.4	7e-33	23	79	3	60
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY+eC++NhAa +Gg+avDGC+Efmps geegt+ al CaACgCHRnF Rreve+e Solyc03g061620.1.1 23 TVRYRECQRNHAAGVGGYAVDGCREFMPS-GEEGTPGALSCAACGCHRNFRRREVETE 79 79************************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-25	19	87	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.4E-30	24	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.9E-27	25	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.257	26	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MTKRHEDDEE NDGSLHTSIT IRTVRYRECQ RNHAAGVGGY AVDGCREFMP SGEEGTPGAL 60 SCAACGCHRN FRRREVETEV ASNCSSPS*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc03g061620.1.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC122544	3e-14	Genomic sequence for Lycopersicon esculentum, clone L136C6, complete sequence
GenBank	AC226507	3e-14	Solanum lycopersicum chromosome 2 clone C02HBa0136C06, complete sequence
GenBank	AM261628	3e-14	Solanum lycopersicum mRNA for mini zinc finger protein (ima gene)
GenBank	EU161283	3e-14	Solanum lycopersicum clone BAC L136C6 transcription factor style2.1 gene, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004234800.1	2e-59	mini zinc finger protein 2-like
Swissprot	Q9LJW5	1e-32	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A3Q7FIA8	4e-58	A0A3Q7FIA8_SOLLC; Uncharacterized protein
STRING	Solyc03g061620.1.1	7e-59	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	6e-35	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Solyc03g061620.1.1
Entrez Gene	101260998

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]