PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc03g098260.1.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB_related

Protein Properties

Length: 42aa MW: 4769.4 Da PI: 9.4063

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc03g098260.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42	2.1e-13	4	40	1	38
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 rg W + Ede+l ++v+++G+++W++Ia ++ gR++ Solyc03g098260.1.1 4 RGHWRPHEDEKLRELVAKYGPHNWNAIALNLQ-GRSGL 40 899***************************.986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.506	1	41	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.1E-13	3	40	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.36E-10	3	41	IPR009057	Homeodomain-like
Pfam	PF00249	3.1E-12	4	41	IPR001005	SANT/Myb domain
CDD	cd00167	1.13E-9	7	41	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 42 aa Download sequence Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI ALNLQGRSGL Q*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: In elongating stem internodes, expressed in developing protoxylem and elongating interfascicular fiber cells. In non-elongating internodes, expressed in developing metaxylem cells and interfascicular fibers. In roots, expressed in developing secondary xylem. {ECO:0000269\|PubMed:18952777}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers. {ECO:0000269\|PubMed:18952777}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc03g098260.1.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006364392.1	1e-21	PREDICTED: transcriptional activator Myb-like isoform X1
Refseq	XP_006364393.1	1e-21	PREDICTED: transcriptional activator Myb-like isoform X2
Refseq	XP_010318340.1	1e-21	transcription factor MYB54-like
Refseq	XP_015069302.1	1e-21	transcription factor MYB54-like isoform X1
Refseq	XP_015069303.1	1e-21	transcription factor MYB54-like isoform X2
Swissprot	Q9FX36	2e-17	MYB54_ARATH; Transcription factor MYB54
TrEMBL	A0A3Q7FNT7	3e-21	A0A3Q7FNT7_SOLLC; Uncharacterized protein
TrEMBL	M1D2B8	2e-20	M1D2B8_SOLTU; Uncharacterized protein
STRING	Solyc03g098260.1.1	2e-23	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G73410.1	7e-20	myb domain protein 54

Link Out ? help Back to Top
Phytozome	Solyc03g098260.1.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]