PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc03g116070.1.1

Common Name

LOC101253676

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

ZF-HD

Protein Properties

Length: 84aa MW: 9037.14 Da PI: 8.5074

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc03g116070.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	99.8	1.9e-31	21	74	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +vrY eC++NhAa++Gg+avDGC+Efm++ g++ +aal+CaACgCHRnFHRrev+ Solyc03g116070.1.1 21 NVRYVECQRNHAANIGGYAVDGCREFMAT-GDD-GTAALTCAACGCHRNFHRREVD 74 79************************9.555.4789*************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-14	2	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.8E-29	21	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.7E-25	23	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.8	24	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0048509	Biological Process	regulation of meristem development

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MMKKRQVVVR RISSGSSTIR NVRYVECQRN HAANIGGYAV DGCREFMATG DDGTAALTCA 60 ACGCHRNFHR REVDGGEVVS ESS*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.7034	1e-141	leaf\| root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots, stems and flowers, present in seedlings and leaves, and weakly observed in inflorescence and siliques. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:18713354}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc03g116070.1.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015069341.1	7e-55	mini zinc finger protein 3
Refseq	XP_019068279.1	7e-55	mini zinc finger protein 3
Swissprot	Q2Q493	8e-33	MIF3_ARATH; Mini zinc finger protein 3
TrEMBL	A0A3Q7FTE0	2e-53	A0A3Q7FTE0_SOLLC; Uncharacterized protein
STRING	Solyc03g116070.1.1	3e-54	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G18835.1	2e-23	mini zinc finger

Link Out ? help Back to Top
Phytozome	Solyc03g116070.1.1
Entrez Gene	101253676

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505]