PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc04g009520.2.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

NF-YB

Protein Properties

Length: 87aa MW: 9844.32 Da PI: 5.8812

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc04g009520.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	144.4	2.6e-45	1	78	17	94
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 mkk lP+naki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddl+w+l+tlGfedy+eplk+yl +yre+e Solyc04g009520.2.1 1 MKKGLPTNAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLIWSLTTLGFEDYIEPLKAYLIRYREME 78 9***************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	2.0E-20	1	54	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	1.3E-39	1	78	IPR009072	Histone-fold
SuperFamily	SSF47113	2.9E-30	1	78	IPR009072	Histone-fold
PRINTS	PR00615	3.0E-20	19	37	No hit	No description
PROSITE pattern	PS00685	0	22	38	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.0E-20	38	56	No hit	No description
PRINTS	PR00615	3.0E-20	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MKKGLPTNAK IAKEAKDTVQ ECVSEFISFI TSEASDKCQK EKRKTINGDD LIWSLTTLGF 60 EDYIEPLKAY LIRYREMEVC IASPHQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-35	1	76	17	92	Transcription factor HapC (Eurofung)
4g92_B	1e-35	1	76	17	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269\|PubMed:11867211}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc04g009520.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CU326358	2e-67	S.lycopersicum DNA sequence from clone SL_MboI-40B16 on chromosome 4, complete sequence

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004236819.1	2e-51	nuclear transcription factor Y subunit B-10
Refseq	XP_010319294.1	2e-51	nuclear transcription factor Y subunit B-10
Refseq	XP_010319295.1	2e-51	nuclear transcription factor Y subunit B-10
Swissprot	Q67XJ2	3e-45	NFYBA_ARATH; Nuclear transcription factor Y subunit B-10
TrEMBL	A0A1U8GVY7	7e-49	A0A1U8GVY7_CAPAN; nuclear transcription factor Y subunit B-1-like isoform X1
STRING	Solyc04g009520.2.1	3e-58	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356
Representative plant	OGRP168	17	170

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G53340.1	1e-47	nuclear factor Y, subunit B10

Link Out ? help Back to Top
Phytozome	Solyc04g009520.2.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]