PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc04g025050.1.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

M-type_MADS

Protein Properties

Length: 57aa MW: 6259.52 Da PI: 11.0693

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc04g025050.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	62.2	5.9e-20	2	47	4	49
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 +n++n vtfsk r g++KKA+ L+ LC+ae+++++fs++gk++ + Solyc04g025050.1.1 2 KNTRNLRVTFSKHRVGLFKKASKLCMLCGAEISIVVFSPNGKVFSF 47 799****************************************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.1E-13	1	50	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	18.25	1	51	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.4E-21	2	47	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-18	2	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.8E-10	13	28	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.8E-10	28	49	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
MKNTRNLRVT FSKHRVGLFK KASKLCMLCG AEISIVVFSP NGKVFSFGHL SMDTLI*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during the syncytial endosperm development. {ECO:0000269\|PubMed:18334668}.
Uniprot	TISSUE SPECIFICITY: Expressed in the endosperm but not in the embryo. Detected in young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:18334668}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc04g025050.1.1

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015169063.1	9e-24	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	3e-22	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	A0A3Q7G302	1e-32	A0A3Q7G302_SOLLC; Uncharacterized protein
STRING	Solyc04g025050.1.1	2e-33	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA204	24	223
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	1e-24	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	Solyc04g025050.1.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]