![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc04g049910.2.1 | ||||||||
| Common Name | LOC101251575 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 166aa MW: 17776.8 Da PI: 4.8585 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.9 | 9.6e-56 | 27 | 122 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
reqdr+lPian++rimkk+lPan+ki+kd+k+tvqecvsefisf+tseasdkcq+ekrktingddll alatlGfedy+eplkvyl++yre
Solyc04g049910.2.1 27 REQDRYLPIANIGRIMKKALPANGKIAKDSKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLSALATLGFEDYIEPLKVYLTRYRE 117
89***************************************************************************************** PP
NF-YB 93 legek 97
+eg+
Solyc04g049910.2.1 118 MEGDA 122
***96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.6E-52 | 23 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.43E-38 | 29 | 124 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.9E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.7E-20 | 60 | 78 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.7E-20 | 79 | 97 | No hit | No description |
| PRINTS | PR00615 | 4.7E-20 | 98 | 116 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 166 aa Download sequence Send to blast |
MAEPASPGGG GGSHESGGDP SPQSNLREQD RYLPIANIGR IMKKALPANG KIAKDSKDTV 60 QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLSALATLG FEDYIEPLKV YLTRYREMEG 120 DAKGSARVGD ASVRKDVVGC QLGSNTQFMY EGSFAQGLDY GNSQL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 9e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 9e-47 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc04g049910.2.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU457806 | 1e-121 | S.lycopersicum DNA sequence from clone SL_MboI-28J22 on chromosome 4, complete sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004237524.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
| Refseq | XP_010319840.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
| Refseq | XP_025886490.1 | 1e-119 | nuclear transcription factor Y subunit B-10-like | ||||
| Swissprot | Q8VYK4 | 4e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0V0I0W4 | 1e-117 | A0A0V0I0W4_SOLCH; Putative transcription factor NF-Y CCAAT-binding-like protein-like | ||||
| TrEMBL | Q2XTB9 | 1e-117 | Q2XTB9_SOLTU; Transcription factor NF-Y CCAAT-binding-like protein-like | ||||
| STRING | Solyc04g049910.2.1 | 1e-119 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 4e-72 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc04g049910.2.1 |
| Entrez Gene | 101251575 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




