![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc04g050080.1.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9791.36 Da PI: 10.3723 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.1 | 5.5e-15 | 8 | 53 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+ rW + Ed+ll ++v+++G ++W++I + + gR+ k+c+ rw +
Solyc04g050080.1.1 8 KRRWNPKEDDLLQKLVEEHGEKNWSLIVQLIL-GRSKKSCRFRWCNQ 53
579****************************9.***********985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.4E-19 | 2 | 57 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.372 | 3 | 58 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.76E-20 | 5 | 80 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.7E-13 | 7 | 56 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.51E-11 | 10 | 52 | No hit | No description |
| Pfam | PF13921 | 1.5E-16 | 11 | 68 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.0E-6 | 58 | 80 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MKKKSMIKRR WNPKEDDLLQ KLVEEHGEKN WSLIVQLILG RSKKSCRFRW CNQLNPQVDR 60 RPFTLDEDDI IIKDHAKFGN Q* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 3e-16 | 6 | 81 | 2 | 77 | MYB PROTO-ONCOGENE PROTEIN |
| 1mse_C | 3e-16 | 6 | 81 | 2 | 77 | C-Myb DNA-Binding Domain |
| 1msf_C | 3e-16 | 6 | 81 | 2 | 77 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc04g050080.1.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027772392.1 | 2e-46 | transcription factor MYB77-like | ||||
| Swissprot | O23160 | 1e-29 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A3Q7GVU8 | 2e-52 | A0A3Q7GVU8_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc04g050080.1.1 | 4e-53 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA18536 | 2 | 4 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G37260.1 | 6e-32 | myb domain protein 73 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc04g050080.1.1 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




