PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc05g015850.2.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

WRKY

Protein Properties

Length: 173aa MW: 19878.5 Da PI: 9.7257

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc05g015850.2.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	106.4	1.5e-33	93	151	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d++vv++tYeg H h+ Solyc05g015850.2.1 93 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLSKDEEVVVTTYEGMHSHP 151 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.3E-34	78	151	IPR003657	WRKY domain
SuperFamily	SSF118290	7.06E-30	85	152	IPR003657	WRKY domain
PROSITE profile	PS50811	30.458	88	153	IPR003657	WRKY domain
SMART	SM00774	2.2E-39	93	152	IPR003657	WRKY domain
Pfam	PF03106	2.8E-27	94	151	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000122	Biological Process	negative regulation of transcription from RNA polymerase II promoter
GO:0010055	Biological Process	atrichoblast differentiation
GO:0032107	Biological Process	regulation of response to nutrient levels
GO:0043620	Biological Process	regulation of DNA-templated transcription in response to stress
GO:0048527	Biological Process	lateral root development
GO:0005634	Cellular Component	nucleus
GO:0001046	Molecular Function	core promoter sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
MENYATIFPS ASSSSSHHDG YVSLMNSKSS ISDDTKEELL FQGKNKAGFL GLMASMETPR 60 DIITKKDEVI KSCKKKIKKP RYAFQTRSQV DILDDGYRWR KYGQKAVKNN KFPRSYYRCT 120 HQGCNVKKQV QRLSKDEEVV VTTYEGMHSH PIDKSTDNFE HILSQMQIYN SF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-29	83	150	7	74	Probable WRKY transcription factor 4
2lex_A	3e-29	83	150	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Les.8587	0.0	callus\| cell culture\| leaf

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00506	DAP	Transfer from AT5G13080	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc05g015850.2.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015075730.1	1e-127	probable WRKY transcription factor 75
Swissprot	Q9FYA2	9e-59	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A3Q7GE34	1e-127	A0A3Q7GE34_SOLLC; Uncharacterized protein
STRING	Solyc05g015850.2.1	1e-127	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2204	24	61
Representative plant	OGRP14	17	875

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	2e-60	WRKY DNA-binding protein 75

Link Out ? help Back to Top
Phytozome	Solyc05g015850.2.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]