![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Solyc05g051060.2.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 285aa MW: 32151.8 Da PI: 8.4661 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 102.5 | 2.7e-32 | 113 | 166 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
Solyc05g051060.2.1 113 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 166
9****************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.2E-15 | 110 | 166 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-28 | 111 | 166 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.5E-23 | 113 | 166 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 1.3E-7 | 114 | 165 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009887 | Biological Process | organ morphogenesis | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:0009956 | Biological Process | radial pattern formation | ||||
| GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
| GO:0010158 | Biological Process | abaxial cell fate specification | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 285 aa Download sequence Send to blast |
MNSYHGVSLL DPIKGIPIYH HHQDPKRSSS FGSIYHNNLD HISYSNNSYV TNVASSSPYN 60 RIPIVANRFQ NQQHIYYNGV GLLGSPSSHE SNNFLMRSRF LPKFPTKRSM RAPRMRWTTS 120 LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKTT DKPAASSDGS 180 GEEDLLAIDK ILDQRGPLDG CDEPSTTLWS NSSSSRERLS QANFNESNGL IRSSSFPSQQ 240 RFSHHIEECE YSRAMSYVGC SLDQKNPSLE FTLGRSDWVE KNHD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 5e-17 | 114 | 168 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 5e-17 | 114 | 168 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 5e-17 | 114 | 168 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 5e-17 | 114 | 168 | 3 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 5e-17 | 114 | 168 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269|PubMed:11525739}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Solyc05g051060.2.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC239583 | 0.0 | Solanum lycopersicum chromosome 5 clone C05HBa0201O22, complete sequence | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004240040.1 | 0.0 | transcription repressor KAN1-like isoform X1 | ||||
| Swissprot | Q93WJ9 | 2e-68 | KAN1_ARATH; Transcription repressor KAN1 | ||||
| TrEMBL | A0A3Q7GNA5 | 0.0 | A0A3Q7GNA5_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc05g051060.2.1 | 0.0 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2468 | 23 | 55 | Representative plant | OGRP570 | 15 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16560.1 | 2e-65 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Solyc05g051060.2.1 |




