PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g070910.2.1
Common NameLOC101252193
Organism
Solanum lycopersicum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bHLH
Protein Properties Length: 93aa    MW: 10443.7 Da    PI: 8.5287
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g070910.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH29.99.9e-1020601454
                        HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                        d+iN+  ++L++llP++ + +s K+s + +L+ +++YIksL
  Solyc06g070910.2.1 20 DQINDLVNKLQQLLPELRNRSSDKVSASRVLQDTCNYIKSL 60
                        79**************8799********************9 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.896660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.3E-102076IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.2E-72060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.36E-102079IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0010086Biological Processembryonic root morphogenesis
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSSR HSGGSRISED QINDLVNKLQ QLLPELRNRS SDKVSASRVL QDTCNYIKSL  60
HREVDDLSDR LSELLESSDT TQAALIRSLL MQ*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: At the globular stage, expressed in cells adjacent to the hypophysis and at later embryonic stages, restricted to the future root stem cells. {ECO:0000269|PubMed:20220754}.
UniprotTISSUE SPECIFICITY: Expressed in root and shoot meristems, and young siliques. Low levels detected in all aerial tissues. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:22339648}.
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:22339648}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc06g070910.2.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004241574.11e-57transcription factor PRE3
RefseqXP_006354787.11e-57PREDICTED: transcription factor PRE3-like
RefseqXP_015078920.11e-57transcription factor PRE3-like
SwissprotQ9CA641e-36PRE3_ARATH; Transcription factor PRE3
TrEMBLA0A1U8H0G28e-43A0A1U8H0G2_CAPAN; Transcription factor PRE5
TrEMBLA0A2G2WLU48e-43A0A2G2WLU4_CAPBA; Uncharacterized protein
TrEMBLA0A2G2ZCQ98e-43A0A2G2ZCQ9_CAPAN; transcription factor PRE3
TrEMBLA0A2G3AUT98e-43A0A2G3AUT9_CAPCH; Transcription factor PRE5
STRINGSolyc06g070910.2.14e-57(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35324161
Representative plantOGRP18771240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74500.16e-27activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Lu KJ,De Rybel B,van Mourik H,Weijers D
    Regulation of intercellular TARGET OF MONOPTEROS 7 protein transport in the Arabidopsis root.
    Development, 2018.
    [PMID:29358212]
  5. Baesso B, et al.
    Transcription factors PRE3 and WOX11 are involved in the formation of new lateral roots from secondary growth taproot in A. thaliana.
    Plant Biol (Stuttg), 2018. 20(3): p. 426-432
    [PMID:29450949]