PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc11g071810.1.1

Common Name

fasciated, LOC100191118

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

YABBY

Protein Properties

Length: 178aa MW: 19906.6 Da PI: 9.6948

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc11g071810.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	232.8	8.4e-72	10	171	4	170
YABBY 4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 sse+vCy+qCnfCntilavsvP + ++++vtvrCGhC+++lsvn+ q+l+ ++ ++l+ ++ + +++++n+k + ++++s+s+ Solyc11g071810.1.1 10 SPSSERVCYLQCNFCNTILAVSVPCSNMLTLVTVRCGHCANMLSVNIGSLIQALPLQDV--QKLQRQQYTNVENNSSNYKAYGSSSSSSSK 98 5689**************************************************996..556666677777777777777666666665 PP YABBY 95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++ ++ + + p++ p irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl Solyc11g071810.1.1 99 FNRYSS--IVSPQIEPKI-PSIRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 171 555533..3334444554.46***************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	3.4E-73	12	171	IPR006780	YABBY protein
SuperFamily	SSF47095	1.96E-8	116	164	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	3.0E-5	119	165	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009001	anatomy	fruit
PO:0009030	anatomy	carpel
PO:0025263	anatomy	locule
PO:0007042	developmental stage	whole plant fruit formation stage

Sequence ? help Back to Top
Protein Sequence Length: 178 aa Download sequence Send to blast
MSFDMTFSSS PSSERVCYLQ CNFCNTILAV SVPCSNMLTL VTVRCGHCAN MLSVNIGSLI 60 QALPLQDVQK LQRQQYTNVE NNSSNYKAYG SSSSSSSKFN RYSSIVSPQI EPKIPSIRPP 120 EKRQRVPSAY NRFIKEEIQR IKASNPDISH REAFSTAAKN WAHFPHIHFG LKLEGNK*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269\|PubMed:10457020}.
Uniprot	TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269\|PubMed:10457020}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
Studies indicate that the fruit shape genes SUN (EU491503) OVATE, and FASCIATED (AK248039) belong to IQD/SUN, OFP and the YABBY gene family, respectively. [PMID: 23371549]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc11g071810.1.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU557674	0.0	Solanum lycopersicum FAS protein (fasciated) mRNA, complete cds

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001234390.1	1e-130	YABBY transcription factor
Swissprot	Q9XFB0	7e-67	YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBL	B2YHV8	1e-128	B2YHV8_SOLLC; FAS protein
STRING	Solyc11g071810.1.1	1e-129	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163
Representative plant	OGRP2210	12	36

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08465.1	3e-64	YABBY family protein

Link Out ? help Back to Top
Phytozome	Solyc11g071810.1.1
Entrez Gene	100191118

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Cong B,Barrero LS,Tanksley SD Regulatory change in YABBY-like transcription factor led to evolution of extreme fruit size during tomato domestication. Nat. Genet., 2008. 40(6): p. 800-4 [PMID:18469814] Huang Z,Van Houten J,Gonzalez G,Xiao H,van der Knaap E Genome-wide identification, phylogeny and expression analysis of SUN, OFP and YABBY gene family in tomato. Mol. Genet. Genomics, 2013. 288(3-4): p. 111-29 [PMID:23371549] Sacharowski SP, et al. SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development. Plant Cell, 2015. 27(7): p. 1889-906 [PMID:26106148]