PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Solyc12g088610.1.1

Organism

Solanum lycopersicum

Taxonomic ID

4081

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB_related

Protein Properties

Length: 85aa MW: 9910.95 Da PI: 10.2637

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Solyc12g088610.1.1	genome	ITAG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.3	3.1e-17	11	53	3	46
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 W +eEdell ++vkq+G+++W I + ++ R++k+c++rw + Solyc12g088610.1.1 11 YWNPEEDELLQKLVKQHGTKNWFVIGQLIP-DRSGKSCRLRWCD 53 6***************************.*********76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.808	1	59	IPR017930	Myb domain
SMART	SM00717	6.1E-13	8	57	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.58E-16	11	59	IPR009057	Homeodomain-like
Pfam	PF00249	6.7E-16	11	54	IPR001005	SANT/Myb domain
CDD	cd00167	6.57E-13	12	51	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-16	12	56	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MNKKCQKKCL YWNPEEDELL QKLVKQHGTK NWFVIGQLIP DRSGKSCRLR WCDQLSSKWI 60 INLLLLKKMI LLSILMPNLI INGT*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:23809151, ECO:0000269\|PubMed:24894996}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Solyc12g088610.1.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salt stress. {ECO:0000269\|PubMed:23809151}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010691674.1	3e-19	PREDICTED: transcription factor MYB44-like
Refseq	XP_023732430.1	8e-19	transcription factor MYB44-like
Swissprot	O23160	1e-18	MYB73_ARATH; Transcription factor MYB73
TrEMBL	A0A3Q7JCQ0	8e-53	A0A3Q7JCQ0_SOLLC; Uncharacterized protein
STRING	Solyc12g088610.1.1	1e-53	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA30541	2	2
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37260.1	8e-19	myb domain protein 73

Link Out ? help Back to Top
Phytozome	Solyc12g088610.1.1

Publications ? help Back to Top
Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments. Theor. Appl. Genet., 2005. 112(1): p. 72-84 [PMID:16208505] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]