PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopen01g004470.1

Organism

Solanum pennellii

Taxonomic ID

28526

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

bZIP

Protein Properties

Length: 146aa MW: 16720 Da PI: 9.8082

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopen01g004470.1	genome	spenn	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	52.5	1e-16	78	135	4	62
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 ++r rrk+kNRe+A rsR+RK+a+ eL +kv Le+eN++Lkke +el+++ ++l se Sopen01g004470.1 78 DRRLRRKIKNRESAARSRARKQAYHNELVNKVSHLEEENMKLKKE-KELENMLSELSSE 135 6899***************************************76.8999999999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	8.5E-13	75	134	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.76	77	122	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	6.7E-14	78	134	IPR004827	Basic-leucine zipper domain
CDD	cd14707	2.18E-16	79	125	No hit	No description
SuperFamily	SSF57959	1.25E-11	79	125	No hit	No description
Gene3D	G3DSA:1.20.5.170	3.1E-14	79	133	No hit	No description
PROSITE pattern	PS00036	0	82	97	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MNSQERELTL GETTLEDYLV KAGLFVADAS LGHTMSLDNP MAMQNFVPPI GLSPSPSLSD 60 TPVSDRKRGA MDIDKTIDRR LRRKIKNRES AARSRARKQA YHNELVNKVS HLEEENMKLK 120 KEKELENMLS ELSSEPRYQL RRTTSF

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975440	1e-166	HG975440.1 Solanum pennellii chromosome ch01, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019069565.1	1e-102	LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2
Swissprot	Q9C5Q2	9e-27	AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBL	M1C2P8	2e-97	M1C2P8_SOLTU; Uncharacterized protein
STRING	Solyc01g008980.2.1	1e-102	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12596	16	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G41070.3	3e-12	bZIP family protein

Publications ? help Back to Top
Haas BJ, et al. Full-length messenger RNA sequences greatly improve genome annotation. Genome Biol., 2002. 3(6): p. RESEARCH0029 [PMID:12093376] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153]