![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen01g026420.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 112aa MW: 12696.6 Da PI: 8.4912 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 44.9 | 1.5e-14 | 15 | 57 | 1 | 43 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
k+i+nk +tfskRr+g+ KKA+EL + Cd+++ ++++s+
Sopen01g026420.1 15 KKIKNKDALLTTFSKRREGLYKKASELVTECDVDIGIMMISPA 57
689*************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-14 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 17.815 | 7 | 55 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.27E-17 | 8 | 58 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.3E-7 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.5E-16 | 16 | 57 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 1.28E-13 | 25 | 56 | No hit | No description |
| PRINTS | PR00404 | 4.3E-7 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MEEKKTKGRQ KIPIKKIKNK DALLTTFSKR REGLYKKASE LVTECDVDIG IMMISPAEIG 60 QKGWWESIER LNADEVVIFE AWLSDTFSKM GHHLNQLENG ASSSLGREPF GV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975440 | 7e-91 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016577056.1 | 2e-40 | PREDICTED: agamous-like MADS-box protein AGL61 isoform X2 | ||||
| Swissprot | Q9FKK2 | 3e-13 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | A0A1U8H0P0 | 4e-39 | A0A1U8H0P0_CAPAN; agamous-like MADS-box protein AGL61 isoform X2 | ||||
| STRING | Solyc04g056740.1.1 | 1e-28 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA382 | 20 | 138 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60440.1 | 1e-15 | AGAMOUS-like 62 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




