![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen01g028840.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 138aa MW: 15030.6 Da PI: 5.9617 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 168.3 | 9.5e-53 | 22 | 117 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
reqdr+lPianv+rimk++lP nakisk+aket+qecvsefi+fvt+easdkc++e+rkt+ngdd++wal+tlGf+dy +lk yl++yre e
Sopen01g028840.1 22 REQDRLLPIANVGRIMKNILPPNAKISKEAKETMQECVSEFIGFVTGEASDKCRKERRKTVNGDDICWALGTLGFDDYSGALKRYLHRYRESE 114
89******************************************************************************************* PP
NF-YB 95 gek 97
gek
Sopen01g028840.1 115 GEK 117
997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.6E-49 | 18 | 122 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.34E-37 | 24 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.4E-26 | 27 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.4E-15 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 1.4E-15 | 74 | 92 | No hit | No description |
| PRINTS | PR00615 | 1.4E-15 | 93 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 138 aa Download sequence Send to blast |
MSQQNIGGAS SSNDEGAAGS SREQDRLLPI ANVGRIMKNI LPPNAKISKE AKETMQECVS 60 EFIGFVTGEA SDKCRKERRK TVNGDDICWA LGTLGFDDYS GALKRYLHRY RESEGEKVNQ 120 EQAGGGGSGS NQPRNFLD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-43 | 22 | 112 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-43 | 22 | 112 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975440 | 0.0 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015087634.1 | 5e-99 | nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 3e-60 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A3Q7EG93 | 3e-96 | A0A3Q7EG93_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc01g067130.2.1 | 5e-97 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-62 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




