![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen03g014850.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 88aa MW: 9661.59 Da PI: 6.3328 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 111.1 | 5.7e-35 | 23 | 79 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY+eC++NhAas+Gg+avDGC+Efmps geegt+ al CaACgCHRnFHRreve+e
Sopen03g014850.1 23 TVRYRECQRNHAASVGGYAVDGCREFMPS-GEEGTPGALSCAACGCHRNFHRREVETE 79
79**************************9.999*********************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 9.0E-27 | 19 | 87 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.9E-32 | 24 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 9.3E-29 | 25 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.258 | 26 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MTKRHEVNEE NDGSMHTSIT IRTVRYRECQ RNHAASVGGY AVDGCREFMP SGEEGTPGAL 60 SCAACGCHRN FHRREVETEV ASDCSSPS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975442 | 1e-147 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015069508.1 | 1e-59 | mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 7e-35 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A3Q7FIA8 | 1e-53 | A0A3Q7FIA8_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc03g061620.1.1 | 2e-54 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 3e-37 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




