![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen03g024790.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 83aa MW: 10098.8 Da PI: 10.5201 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 54.3 | 3.1e-17 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd++l+d+v ++G +W++ ++ g+ Rt+k+c++rw +yl
Sopen03g024790.1 9 KGTWSPEEDQKLKDYVMRFGIWNWNLMPKFAGLSRTGKSCRLRWMNYL 56
799*****************99*************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 19.93 | 1 | 60 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.1E-22 | 7 | 59 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 9.9E-13 | 8 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.1E-15 | 9 | 56 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 7.69E-23 | 10 | 83 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.97E-9 | 11 | 56 | No hit | No description |
| PROSITE profile | PS50090 | 4.31 | 57 | 83 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-8 | 60 | 83 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MEDIIIIKKG TWSPEEDQKL KDYVMRFGIW NWNLMPKFAG LSRTGKSCRL RWMNYLRPDV 60 KRGPFSMEER ERVIKMYQQL GNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 4e-14 | 9 | 83 | 7 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975442 | 2e-69 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
| GenBank | HG975515 | 2e-69 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004235435.1 | 1e-55 | transcription factor MYB4-like | ||||
| Swissprot | Q9LDR8 | 2e-29 | MY102_ARATH; Transcription factor MYB102 | ||||
| TrEMBL | A0A3Q7GB60 | 2e-54 | A0A3Q7GB60_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc03g093940.1.1 | 4e-55 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12 | 24 | 2154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21440.1 | 8e-32 | MYB-like 102 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




