![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen03g028400.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 163aa MW: 18865.8 Da PI: 10.3928 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 143.8 | 9.4e-45 | 14 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
lppGfrF+Ptdee+v +yL +k+ + +l++ ++i+e++i+k +Pw+Lp v e++ yfFs+++ ky++g+r+nrat gyWk +g dk+++
Sopen03g028400.2 14 LPPGFRFQPTDEEIVFQYLIRKTFSCPLPA-SIIPEINICKNDPWNLPGDV---EQDRYFFSNKEAKYRNGNRANRATIGGYWKPSGLDKQII 102
79****************************.89***************554...5689*********************************99 PP
NAM 94 sk.kgelvglkktLvfykg.rapkgektdWvmheyrl 128
++ ++ +g+kktLvfykg +a+++ +tdW+mheyrl
Sopen03g028400.2 103 CSkRKPIIGMKKTLVFYKGkSASQAYRTDWIMHEYRL 139
97455569*********995678889*********98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.41E-47 | 10 | 145 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 46.387 | 14 | 163 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.9E-24 | 15 | 139 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MDKFNFVKDG AIKLPPGFRF QPTDEEIVFQ YLIRKTFSCP LPASIIPEIN ICKNDPWNLP 60 GDVEQDRYFF SNKEAKYRNG NRANRATIGG YWKPSGLDKQ IICSKRKPII GMKKTLVFYK 120 GKSASQAYRT DWIMHEYRLV LPKNSSSNLH VHFNKSSSQQ AKK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 1e-37 | 12 | 160 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 1e-37 | 12 | 160 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 1e-37 | 12 | 160 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 1e-37 | 12 | 160 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 2e-37 | 12 | 160 | 18 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 1e-37 | 12 | 160 | 15 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 1e-37 | 12 | 160 | 15 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975442 | 1e-167 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015069739.1 | 1e-118 | NAC domain-containing protein 83 | ||||
| Swissprot | Q9FY93 | 4e-64 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
| TrEMBL | A0A3Q7GCT8 | 1e-116 | A0A3Q7GCT8_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc03g097650.2.1 | 1e-117 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13180.1 | 2e-66 | NAC domain containing protein 83 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




