![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen05g003070.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 146aa MW: 16376.6 Da PI: 7.6083 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 171.5 | 1.9e-53 | 2 | 107 | 34 | 139 |
Whirly 34 lllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPv 126
++l++a+a+++r+ydW++kq+f+ls+te++++++l++k+sceffhdp ++ s+eG+vrk+lkvePlpdGsG+f+nlsv+n+l++ +e++++Pv
Sopen05g003070.1 2 VMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGAKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSGHFFNLSVQNKLINLDENIYIPV 94
8******************************************************************************************** PP
Whirly 127 skaefavlrsllv 139
+kaefavl s+++
Sopen05g003070.1 95 TKAEFAVLVSAFN 107
*********9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.6E-58 | 1 | 129 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 2.59E-63 | 1 | 146 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 2.2E-48 | 1 | 104 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006281 | Biological Process | DNA repair | ||||
| GO:0032211 | Biological Process | negative regulation of telomere maintenance via telomerase | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
| GO:0009508 | Cellular Component | plastid chromosome | ||||
| GO:0009570 | Cellular Component | chloroplast stroma | ||||
| GO:0003697 | Molecular Function | single-stranded DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0003723 | Molecular Function | RNA binding | ||||
| GO:0042162 | Molecular Function | telomeric DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MVMLQFAPAA GVRQYDWSRK QVFSLSVTEI GSIISLGAKD SCEFFHDPNK GRSDEGRVRK 60 VLKVEPLPDG SGHFFNLSVQ NKLINLDENI YIPVTKAEFA VLVSAFNFVM PYLLGWHTAV 120 NSFKPEDASR SNNANPRSGA ELEWNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 1e-105 | 1 | 145 | 75 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 1e-105 | 1 | 145 | 75 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 1e-105 | 1 | 145 | 75 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 1e-105 | 1 | 145 | 75 | 219 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JQ670889 | 0.0 | JQ670889.1 Solanum lycopersicum whirly protein (Why3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015074582.1 | 1e-106 | single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| Swissprot | Q9LL85 | 1e-107 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A0V0HSY5 | 1e-104 | A0A0V0HSY5_SOLCH; Putative single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| STRING | PGSC0003DMT400045439 | 1e-105 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA7731 | 24 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14410.1 | 3e-87 | ssDNA-binding transcriptional regulator | ||||




