![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen07g014330.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 117aa MW: 13744.8 Da PI: 10.773 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.9 | 3.1e-15 | 16 | 59 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
WT+eE+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
Sopen07g014330.1 16 WTEEEHRRFLMGLEKLGKGDWRGISRKFVTTRTPTQVASHAQKY 59
*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 14.765 | 8 | 64 | IPR017930 | Myb domain |
| SMART | SM00717 | 4.2E-9 | 12 | 62 | IPR001005 | SANT/Myb domain |
| TIGRFAMs | TIGR01557 | 7.1E-18 | 14 | 62 | IPR006447 | Myb domain, plants |
| SuperFamily | SSF46689 | 1.12E-16 | 15 | 64 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.9E-12 | 16 | 59 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.52E-8 | 16 | 60 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.0E-11 | 16 | 59 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 117 aa Download sequence Send to blast |
MWVPVAARFW VVTVGWTEEE HRRFLMGLEK LGKGDWRGIS RKFVTTRTPT QVASHAQKYF 60 LRHSTHLNKK KRRSSLFDME RRKNKMEESK GDYGNPTSPI SEEIALATKD TLIWSSY |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 68 | 72 | KKKRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975446 | 1e-130 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004242968.1 | 1e-70 | transcription factor MYBS3-like | ||||
| Swissprot | Q7XC57 | 3e-31 | MYBS3_ORYSJ; Transcription factor MYBS3 | ||||
| TrEMBL | M1AKK6 | 2e-61 | M1AKK6_SOLTU; Uncharacterized protein | ||||
| STRING | Solyc07g026680.2.1 | 3e-42 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3385 | 21 | 47 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G56840.1 | 7e-34 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




