![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopen07g027780.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 146aa MW: 16851.8 Da PI: 10.3083 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134.6 | 3.2e-42 | 42 | 117 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cq+e+C++dls+ak+yh+rhkvCe h+k++vv+v+gl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
Sopen07g027780.1 42 CQAEKCNVDLSDAKQYHKRHKVCEYHAKSQVVVVAGLRQRFCQQCSRFHELTEFDESKRSCRRRLAGHNERRRKST 117
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.6E-33 | 36 | 103 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 32.052 | 39 | 116 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.06E-38 | 41 | 119 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 5.7E-32 | 42 | 115 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MEKNDDLLVI STSENTNKKI ITTNNNKKLL SNSSPSSLIR SCQAEKCNVD LSDAKQYHKR 60 HKVCEYHAKS QVVVVAGLRQ RFCQQCSRFH ELTEFDESKR SCRRRLAGHN ERRRKSTSSS 120 SSSSSYADRI HISTQENPTH KNFHLR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 5e-38 | 32 | 115 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00634 | PBM | Transfer from PK22320.1 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975446 | 1e-145 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_027774345.1 | 1e-103 | squamosa promoter-binding protein 1-like, partial | ||||
| Swissprot | Q38741 | 2e-40 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| Swissprot | Q6Z461 | 2e-39 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A3Q7HEQ9 | 2e-78 | A0A3Q7HEQ9_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc07g053810.2.1 | 5e-79 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15270.1 | 8e-39 | squamosa promoter binding protein-like 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




