![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopim02g032190.0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 96aa MW: 10702.1 Da PI: 4.8431 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 75.7 | 6.9e-24 | 27 | 80 | 2 | 55 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcq 55
reqdrf Pianv+r m+k+lP naki+++++ ++qecvsefisfvt+ea++++
Sopim02g032190.0.1 27 REQDRFTPIANVVRNMRKILPPNAKIADESQLVIQECVSEFISFVTGEANNHAS 80
89************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 6.2E-21 | 23 | 80 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.66E-14 | 29 | 82 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.3E-12 | 34 | 80 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MERSMELPSH LNKEIVANEE DLECTIREQD RFTPIANVVR NMRKILPPNA KIADESQLVI 60 QECVSEFISF VTGEANNHAS LSSTRQSPLK TCFGP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 7e-23 | 25 | 76 | 5 | 56 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC246752 | 1e-160 | AC246752.2 Solanum lycopersicum strain Heinz 1706 chromosome 2 clone slm-46o2 map 2, complete sequence. | |||
| GenBank | HG975514 | 1e-160 | HG975514.1 Solanum lycopersicum chromosome ch02, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006356442.2 | 7e-44 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Refseq | XP_015168332.1 | 1e-43 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
| Refseq | XP_015168333.1 | 1e-43 | PREDICTED: nuclear transcription factor Y subunit B-8-like isoform X1 | ||||
| Refseq | XP_015168334.1 | 7e-44 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Swissprot | Q84W66 | 4e-24 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A3Q7EX30 | 2e-63 | A0A3Q7EX30_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc02g032190.1.1 | 3e-64 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA26694 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 1e-26 | nuclear factor Y, subunit B6 | ||||




