PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopim02g077920.0.1

Organism

Solanum pimpinellifolium

Taxonomic ID

4084

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

SBP

Protein Properties

Length: 137aa MW: 15679.6 Da PI: 8.8513

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopim02g077920.0.1	genome	CSHL	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	137.1	5.1e-43	52	127	2	77
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv++C+ad+++ak yhrrhkvCe+hsk+p vl+sgl++rfCqqCsrfh l efD++krsCrrrLa+hnerrrk + Sopim02g077920.0.1 52 CQVDQCTADMADAKPYHRRHKVCEFHSKSPIVLISGLQKRFCQQCSRFHLLAEFDDAKRSCRRRLAGHNERRRKIT 127 *************************************************************************976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	9.5E-55	1	136	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	1.1E-34	45	113	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.043	49	126	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	3.04E-39	50	130	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.2E-32	52	125	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
METNKWEGKR SITEAEKEED EHGSVEEDSK RKRVLTLSGR KLVGEGSAHP SCQVDQCTAD 60 MADAKPYHRR HKVCEFHSKS PIVLISGLQK RFCQQCSRFH LLAEFDDAKR SCRRRLAGHN 120 ERRRKITYDS HGENLG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	3e-37	52	125	11	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU486692	1e-163	EU486692.2 Solanum pimpinellifolium isolate CNRGENE_74 genomic sequence.
GenBank	EU486693	1e-163	EU486693.2 Solanum pimpinellifolium isolate CNRGENE_81 genomic sequence.
GenBank	HM155888	1e-163	HM155888.1 Solanum lycopersicum isolate 64_P3CNRDseq genomic sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001306237.1	1e-97	SQUAMOSA promoter binding protein-like
Refseq	XP_015063347.1	1e-97	squamosa promoter-binding protein 1 isoform X1
Swissprot	Q38741	3e-54	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	Q0PY35	3e-96	Q0PY35_SOLLC; Squamosa promoter-binding-like protein
STRING	Solyc02g077920.2.1	4e-97	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	2e-44	squamosa promoter binding protein-like 3

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]