PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g094290.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 114aa    MW: 13079.1 Da    PI: 11.1393
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g094290.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP120.71.7e-373199270
                 TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
                        a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlq+a+p+i+++tg ++++a
  Sopim02g094290.0.1 31 APKRKSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQKAEPSIIAATGHGTIQA 99
                        789*************************************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.5E-3036100IPR005333Transcription factor, TCP
PROSITE profilePS5136927.9853791IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MKRQNTNNTM EMKDFQIGIA EKDEAKKHQL APKRKSNKDR HTKVEGRGRR IRMPALCAAR  60
IFQLTRELGH KSDGETIQWL LQKAEPSIIA ATGHGTIQAS LYRRLDPLFR NRE*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2154570.0AC215457.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02SLe0061K08, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025885512.13e-67LOW QUALITY PROTEIN: transcription factor TCP20
SwissprotQ9LSD56e-45TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A3Q7FEE81e-78A0A3Q7FEE8_SOLLC; Uncharacterized protein
STRINGSolyc02g094290.1.12e-79(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.13e-47TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]