PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sopim03g098260.0.1

Organism

Solanum pimpinellifolium

Taxonomic ID

4084

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon

Family

MYB_related

Protein Properties

Length: 42aa MW: 4769.4 Da PI: 9.4063

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sopim03g098260.0.1	genome	CSHL	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42	2.1e-13	4	40	1	38
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38 rg W + Ede+l ++v+++G+++W++Ia ++ gR++ Sopim03g098260.0.1 4 RGHWRPHEDEKLRELVAKYGPHNWNAIALNLQ-GRSGL 40 899***************************.986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.506	1	41	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.1E-13	3	40	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.36E-10	3	41	IPR009057	Homeodomain-like
Pfam	PF00249	3.1E-12	4	41	IPR001005	SANT/Myb domain
CDD	cd00167	1.13E-9	7	41	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 42 aa Download sequence Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI ALNLQGRSGL Q*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers. {ECO:0000269\|PubMed:18952777}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975442	6e-58	HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBank	HG975515	6e-58	HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006364392.1	1e-21	PREDICTED: transcriptional activator Myb-like isoform X1
Refseq	XP_006364393.1	1e-21	PREDICTED: transcriptional activator Myb-like isoform X2
Refseq	XP_010318340.1	1e-21	transcription factor MYB54-like
Refseq	XP_015069302.1	1e-21	transcription factor MYB54-like isoform X1
Refseq	XP_015069303.1	1e-21	transcription factor MYB54-like isoform X2
Swissprot	Q9FX36	2e-17	MYB54_ARATH; Transcription factor MYB54
TrEMBL	A0A3Q7FNT7	3e-21	A0A3Q7FNT7_SOLLC; Uncharacterized protein
TrEMBL	M1D2B8	2e-20	M1D2B8_SOLTU; Uncharacterized protein
STRING	Solyc03g098260.1.1	2e-23	(Solanum lycopersicum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G73410.1	7e-20	myb domain protein 54

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]