![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopim03g098260.0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 42aa MW: 4769.4 Da PI: 9.4063 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42 | 2.1e-13 | 4 | 40 | 1 | 38 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
rg W + Ede+l ++v+++G+++W++Ia ++ gR++
Sopim03g098260.0.1 4 RGHWRPHEDEKLRELVAKYGPHNWNAIALNLQ-GRSGL 40
899*****************************.**986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.506 | 1 | 41 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.1E-13 | 3 | 40 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.36E-10 | 3 | 41 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.1E-12 | 4 | 41 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.13E-9 | 7 | 41 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 42 aa Download sequence Send to blast |
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI ALNLQGRSGL Q* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers. {ECO:0000269|PubMed:18952777}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975442 | 6e-58 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. | |||
| GenBank | HG975515 | 6e-58 | HG975515.1 Solanum lycopersicum chromosome ch03, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006364392.1 | 1e-21 | PREDICTED: transcriptional activator Myb-like isoform X1 | ||||
| Refseq | XP_006364393.1 | 1e-21 | PREDICTED: transcriptional activator Myb-like isoform X2 | ||||
| Refseq | XP_010318340.1 | 1e-21 | transcription factor MYB54-like | ||||
| Refseq | XP_015069302.1 | 1e-21 | transcription factor MYB54-like isoform X1 | ||||
| Refseq | XP_015069303.1 | 1e-21 | transcription factor MYB54-like isoform X2 | ||||
| Swissprot | Q9FX36 | 2e-17 | MYB54_ARATH; Transcription factor MYB54 | ||||
| TrEMBL | A0A3Q7FNT7 | 3e-21 | A0A3Q7FNT7_SOLLC; Uncharacterized protein | ||||
| TrEMBL | M1D2B8 | 2e-20 | M1D2B8_SOLTU; Uncharacterized protein | ||||
| STRING | Solyc03g098260.1.1 | 2e-23 | (Solanum lycopersicum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G73410.1 | 7e-20 | myb domain protein 54 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




