![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopim04g009520.0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 87aa MW: 9844.32 Da PI: 5.8812 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 144.4 | 2.6e-45 | 1 | 78 | 17 | 94 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
mkk lP+naki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddl+w+l+tlGfedy+eplk+yl +yre+e
Sopim04g009520.0.1 1 MKKGLPTNAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLIWSLTTLGFEDYIEPLKAYLIRYREME 78
9***************************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 2.0E-20 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 1.3E-39 | 1 | 78 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.9E-30 | 1 | 78 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 3.0E-20 | 19 | 37 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 22 | 38 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.0E-20 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 3.0E-20 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MKKGLPTNAK IAKEAKDTVQ ECVSEFISFI TSEASDKCQK EKRKTINGDD LIWSLTTLGF 60 EDYIEPLKAY LIRYREMEVC IASPHQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-35 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-35 | 1 | 76 | 17 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU326358 | 6e-66 | CU326358.5 S.lycopersicum DNA sequence from clone SL_MboI-40B16 on chromosome 4, complete sequence. | |||
| GenBank | HG975516 | 6e-66 | HG975516.1 Solanum lycopersicum chromosome ch04, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004236819.1 | 2e-51 | nuclear transcription factor Y subunit B-10 | ||||
| Refseq | XP_010319294.1 | 2e-51 | nuclear transcription factor Y subunit B-10 | ||||
| Refseq | XP_010319295.1 | 2e-51 | nuclear transcription factor Y subunit B-10 | ||||
| Swissprot | Q67XJ2 | 3e-45 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A1U8GVY7 | 7e-49 | A0A1U8GVY7_CAPAN; nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| STRING | Solyc04g009520.2.1 | 3e-58 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 1e-47 | nuclear factor Y, subunit B10 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




