 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopim06g035570.0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 55aa MW: 6224.26 Da PI: 11.2887 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 93.8 | 7.7e-30 | 2 | 52 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng++KKA+ELSvLCda+va+iifs++g+l+ +ss
Sopim06g035570.0.1 2 KRIENATSRQVTFSKRRNGVIKKAYELSVLCDAQVALIIFSNKGRLFQFSS 52
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 27.656 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.4E-31 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 7.06E-26 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-26 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-18 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.2E-18 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 55 aa Download sequence Send to blast |
MKRIENATSR QVTFSKRRNG VIKKAYELSV LCDAQVALII FSNKGRLFQF SSSW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1egw_A | 6e-17 | 3 | 53 | 9 | 59 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_B | 6e-17 | 3 | 53 | 9 | 59 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_C | 6e-17 | 3 | 53 | 9 | 59 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_D | 6e-17 | 3 | 53 | 9 | 59 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1n6j_A | 8e-17 | 1 | 53 | 7 | 59 | Myocyte-specific enhancer factor 2B |
| 1n6j_B | 8e-17 | 1 | 53 | 7 | 59 | Myocyte-specific enhancer factor 2B |
| 1tqe_P | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 3mu6_A | 6e-17 | 3 | 53 | 9 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 6e-17 | 3 | 53 | 9 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 6e-17 | 3 | 53 | 9 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 6e-17 | 3 | 53 | 9 | 59 | Myocyte-specific enhancer factor 2A |
| 6c9l_A | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 7e-17 | 3 | 53 | 10 | 60 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975518 | 5e-87 | HG975518.1 Solanum lycopersicum chromosome ch06, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019069748.1 | 2e-30 | MADS-box protein AGL42-like isoform X2 | ||||
| Swissprot | Q9FIS1 | 2e-26 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A3Q7GTV0 | 5e-29 | A0A3Q7GTV0_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc06g035570.1.1 | 9e-32 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.4 | 8e-29 | AGAMOUS-like 42 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|