![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sopim11g039750.0.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 61aa MW: 7047.95 Da PI: 7.5074 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 31 | 5.9e-10 | 24 | 59 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
rg W Ede+l ++v+++G+++ +Ia++++ gR++
Sopim11g039750.0.1 24 RGHWRSHEDERLRELVEKYGPHNCYAIAQKLQ-GRSD 59
899*****************************.**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 8.58E-7 | 16 | 59 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 10.246 | 19 | 60 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-9 | 22 | 59 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.2E-7 | 24 | 59 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.18E-5 | 27 | 59 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MESSLLFSSL FFSPHNCVYS MCSRGHWRSH EDERLRELVE KYGPHNCYAI AQKLQGRSDL 60 * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975523 | 2e-59 | HG975523.1 Solanum lycopersicum chromosome ch11, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019244658.1 | 9e-16 | PREDICTED: transcriptional activator Myb-like | ||||
| Swissprot | Q6R0C4 | 1e-14 | MYB52_ARATH; Transcription factor MYB52 | ||||
| TrEMBL | A0A3Q7IV36 | 2e-37 | A0A3Q7IV36_SOLLC; Uncharacterized protein | ||||
| STRING | Solyc11g039750.1.1 | 3e-38 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA30019 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17950.1 | 2e-16 | myb domain protein 52 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




