PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Sp_155320_exug.t2

Common Name

SOVF_155320

Organism

Spinacia oleracea

Taxonomic ID

3562

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia

Family

HB-other

Protein Properties

Length: 120aa MW: 13680.5 Da PI: 7.4521

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Sp_155320_exug.t2	genome	TBVR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	24.8	3.8e-08	51	82	24	55
S--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 24 ypsaeereeLAkklgLterqVkvWFqNrRake 55 +++++e+ LA+ +gL+++q+ +WF N+R ++ Sp_155320_exug.t2 51 KLKESEKVALAEATGLDQKQINNWFINQRKRH 82 67789999*********************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00389	6.9E-4	34	89	IPR001356	Homeobox domain
CDD	cd00086	1.62E-9	44	86	No hit	No description
SuperFamily	SSF46689	2.44E-11	51	99	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.5E-15	52	88	IPR009057	Homeodomain-like
PROSITE profile	PS50071	9.637	54	85	IPR001356	Homeobox domain
Pfam	PF05920	4.0E-10	54	81	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	60	83	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001708	Biological Process	cell fate specification
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010051	Biological Process	xylem and phloem pattern formation
GO:0010089	Biological Process	xylem development
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 120 aa Download sequence Send to blast
MMFSCSSVGT RNSELGTLPK QIADFSLFGC KQDDKPKATC DFNNCNTKPD KLKESEKVAL 60 AEATGLDQKQ INNWFINQRK RHWKPSEDMQ FMVMDGIHPH NPALYMDGHY MGDGPYRFGT

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269\|PubMed:11934861, ECO:0000269\|PubMed:12900451, ECO:0000269\|PubMed:7866029}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010692662.1	1e-43	PREDICTED: homeotic protein knotted-1
Swissprot	P46639	2e-38	KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBL	A0A0K9QRW0	7e-87	A0A0K9QRW0_SPIOL; Uncharacterized protein
STRING	XP_010692662.1	4e-43	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	7e-41	KNOTTED-like from Arabidopsis thaliana

Publications ? help Back to Top
dela Paz JS, et al. Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events. PLoS Genet., 2012. 8(12): p. e1003136 [PMID:23284301] Liu C, et al. Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] Liu B, et al. NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(17): p. 5345-57 [PMID:23963677] Simonini S,Kater MM Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering. Gene, 2016. 587(2): p. 120-31 [PMID:27154816] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA Nonreciprocal complementation of KNOX gene function in land plants. New Phytol., 2017. 216(2): p. 591-604 [PMID:27886385] Woerlen N, et al. Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root. Planta, 2017. 245(6): p. 1079-1090 [PMID:28204875] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Wang X, et al. Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana. Sci China Life Sci, 2018. 61(1): p. 79-87 [PMID:28887625] Simonini S,Stephenson P,Østergaard L A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] Felipo-Benavent A, et al. Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856]