![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sp_183770_oiew.t1 | ||||||||
| Common Name | S1FA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 70aa MW: 7700.39 Da PI: 10.9143 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 146.6 | 4.4e-46 | 2 | 70 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
av++veakGlnPGlivllv+gglll+flvgn+ily+yaqknlPP+kkkP+skkk+kre+lkqGva+PGe
Sp_183770_oiew.t1 2 AVNEVEAKGLNPGLIVLLVIGGLLLTFLVGNFILYTYAQKNLPPKKKKPISKKKMKRERLKQGVAPPGE 70
789*****************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 3.0E-6 | 1 | 70 | No hit | No description |
| Pfam | PF04689 | 7.0E-40 | 6 | 70 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MAVNEVEAKG LNPGLIVLLV IGGLLLTFLV GNFILYTYAQ KNLPPKKKKP ISKKKMKRER 60 LKQGVAPPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | X79543 | 1e-115 | X79543.1 S.oleracea s1fa mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021839302.1 | 7e-42 | DNA-binding protein S1FA | ||||
| Swissprot | P42552 | 6e-43 | S1FA_SPIOL; DNA-binding protein S1FA | ||||
| TrEMBL | A0A0K9QHJ6 | 2e-40 | A0A0K9QHJ6_SPIOL; Uncharacterized protein | ||||
| STRING | XP_010104121.1 | 3e-23 | (Morus notabilis) | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




