![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Sp_209830_pdae.t1 | ||||||||
| Common Name | SOVF_209830 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 71aa MW: 7923.2 Da PI: 10.2905 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 67 | 3.6e-21 | 19 | 71 | 1 | 53 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkq 53
s+yk+kaal+v++++p+f ld g++k++r+G +ll++a+a+++r+ydW++kq
Sp_209830_pdae.t1 19 SIYKGKAALTVEPKAPEFLPLDLGAFKVSREGYVLLQFAPAAGVRQYDWSRKQ 71
7**************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 2.8E-24 | 11 | 71 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 5.26E-22 | 12 | 71 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 3.7E-19 | 20 | 71 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 71 aa Download sequence Send to blast |
MNLWRQCTGG APRVFVGHSI YKGKAALTVE PKAPEFLPLD LGAFKVSREG YVLLQFAPAA 60 GVRQYDWSRK Q |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 3e-31 | 11 | 71 | 35 | 95 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 3e-31 | 11 | 71 | 35 | 95 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 3e-31 | 11 | 71 | 35 | 95 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 3e-31 | 11 | 71 | 35 | 95 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021844622.1 | 4e-37 | single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| Swissprot | Q9LL85 | 9e-32 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A0K9Q7Z7 | 1e-45 | A0A0K9Q7Z7_SPIOL; Uncharacterized protein (Fragment) | ||||
| STRING | XP_010683246.1 | 2e-35 | (Beta vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02740.2 | 9e-32 | ssDNA-binding transcriptional regulator | ||||




