PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_212490_ssmj.t2
Common NameSOVF_212490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family MYB_related
Protein Properties Length: 105aa    MW: 11869.6 Da    PI: 6.8045
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_212490_ssmj.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.65.2e-123774443
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
    Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                       WT+ E ++l++av  +  + Wk++a+ +g gRt+ +++++
  Sp_212490_ssmj.t2 37 WTEKETLQLLEAVMHYRDD-WKRVAEQVG-GRTDTSIIHH 74
                       *****************88.*********.*********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.8473283IPR017884SANT domain
SuperFamilySSF466894.86E-103374IPR009057Homeodomain-like
SMARTSM007175.2E-63381IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-93474IPR009057Homeodomain-like
PfamPF002492.0E-113774IPR001005SANT/Myb domain
CDDcd001677.59E-93774No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MMNSQVPPVS QASFLRVGVT ASEFRRVEIS EPVKAGWTEK ETLQLLEAVM HYRDDWKRVA  60
EQVGGRTDTS IIHHSMILAT QLWLREATLT LTTELPSMRQ ALFGG
Functional Description ? help Back to Top
Source Description
UniProtComponent of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors. May play an essential role in the transition from the vegetative to the reproductive phase of development. May be a positive regulator of ABA signaling. {ECO:0000269|PubMed:12140326, ECO:0000269|PubMed:14682613, ECO:0000269|PubMed:16055636, ECO:0000269|PubMed:19033529}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021858679.13e-63SWI/SNF and RSC complexes subunit ssr2-like isoform X3
SwissprotQ84JG21e-16SWI3B_ARATH; SWI/SNF complex subunit SWI3B
TrEMBLA0A0K9Q8P94e-71A0A0K9Q8P9_SPIOL; Uncharacterized protein
STRINGPOPTR_0002s00620.17e-22(Populus trichocarpa)
Publications ? help Back to Top
  1. Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A
    AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time.
    Nucleic Acids Res., 2002. 30(15): p. 3412-21
    [PMID:12140326]
  2. Zhou C,Miki B,Wu K
    CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis.
    Plant Mol. Biol., 2003. 52(6): p. 1125-34
    [PMID:14682613]
  3. Sarnowski TJ, et al.
    SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development.
    Plant Cell, 2005. 17(9): p. 2454-72
    [PMID:16055636]
  4. Archacki R, et al.
    Genetic analysis of functional redundancy of BRM ATPase and ATSWI3C subunits of Arabidopsis SWI/SNF chromatin remodelling complexes.
    Planta, 2009. 229(6): p. 1281-92
    [PMID:19301030]
  5. Zhu Y,Rowley MJ,Böhmdorfer G,Wierzbicki AT
    A SWI/SNF chromatin-remodeling complex acts in noncoding RNA-mediated transcriptional silencing.
    Mol. Cell, 2013. 49(2): p. 298-309
    [PMID:23246435]
  6. Liu ZW, et al.
    Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis.
    PLoS Genet., 2016. 12(5): p. e1006026
    [PMID:27171427]
  7. Han W, et al.
    The SWI/SNF subunit SWI3B regulates IAMT1 expression via chromatin remodeling in Arabidopsis leaf development.
    Plant Sci., 2018. 271: p. 127-132
    [PMID:29650150]