![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo0G0157900 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 176aa MW: 19436.8 Da PI: 9.408 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 44.5 | 3.7e-14 | 43 | 87 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+W+++Ed+ll + v +G ++W++Ia+ + +t+ qc+ rw++yl
Spipo0G0157900 43 SWSQQEDDLLREQVGIHGIENWTSIAAQFK-DKTGRQCRRRWFTYL 87
6****************************9.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 48.4 | 2.2e-15 | 93 | 137 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g W++eEd ll +a k +G++ W+ Ia+ + gRt++ +k+r++++
Spipo0G0157900 93 KGGWSPEEDALLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFNTL 137
688*******************.*********.***********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.669 | 36 | 87 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-11 | 40 | 89 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.28E-27 | 40 | 134 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.55E-11 | 43 | 87 | No hit | No description |
| Pfam | PF13921 | 2.7E-14 | 44 | 104 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 6.3E-21 | 44 | 94 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 21.118 | 88 | 142 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.1E-15 | 92 | 140 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-22 | 95 | 143 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.56E-11 | 96 | 137 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009553 | Biological Process | embryo sac development | ||||
| GO:0010052 | Biological Process | guard cell differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 176 aa Download sequence Send to blast |
MERTGEEAAR EVAAAGGDGG DGGSGGGRGR GVAPQQKERH VVSWSQQEDD LLREQVGIHG 60 IENWTSIAAQ FKDKTGRQCR RRWFTYLNTE CKKGGWSPEE DALLCEAQKI FGNRWTEIAK 120 VVSGRTDNAV KNRFNTLCKK RLKQEAMTKE NTPHCARSGM EISAFKLVSA QNPRV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 2e-30 | 44 | 142 | 10 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008780751.1 | 3e-70 | transcription factor MYB124 isoform X2 | ||||
| Refseq | XP_017696767.1 | 5e-70 | transcription factor MYB124 isoform X1 | ||||
| Swissprot | Q94FL6 | 3e-63 | MY124_ARATH; Transcription factor MYB124 | ||||
| TrEMBL | A0A1D1YW43 | 8e-73 | A0A1D1YW43_9ARAE; Myb-related protein B | ||||
| STRING | XP_008780751.1 | 1e-69 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8903 | 38 | 47 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G14350.2 | 6e-65 | MYB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo0G0157900 |




