![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo12G0038900 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 158aa MW: 18187.8 Da PI: 8.012 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 165.5 | 1.9e-51 | 18 | 146 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94
lppGfrF Ptdeelv++yL+ kv + + + e+d++++ePw+Lp +k +e+ewyf+s rd+ky+tg r+nrat sgyWkatgkd+ev+s
Spipo12G0038900 18 LPPGFRFYPTDEELVTFYLAGKVFNGGFVGV-DMVEIDLNRCEPWELPDVAKLGEREWYFYSLRDRKYPTGLRTNRATGSGYWKATGKDREVCS 110
79*************************8873.499*************8888899**************************************9 PP
NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrle 129
+ +g l+g+kktLvfykgrap+gekt+Wv+heyrle
Spipo12G0038900 111 AsGGVLIGMKKTLVFYKGRAPRGEKTKWVLHEYRLE 146
977888****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.57E-58 | 6 | 150 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 53.733 | 18 | 157 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.2E-26 | 19 | 145 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010014 | Biological Process | meristem initiation | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 158 aa Download sequence Send to blast |
MEEVLWEMMG EDTNERGLPP GFRFYPTDEE LVTFYLAGKV FNGGFVGVDM VEIDLNRCEP 60 WELPDVAKLG EREWYFYSLR DRKYPTGLRT NRATGSGYWK ATGKDREVCS ASGGVLIGMK 120 KTLVFYKGRA PRGEKTKWVL HEYRLEGDFS RRLACKY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swm_B | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swm_C | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swm_D | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swp_A | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swp_B | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swp_C | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| 3swp_D | 2e-47 | 14 | 145 | 16 | 145 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00241 | DAP | Transfer from AT1G76420 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020535450.1 | 6e-95 | protein CUP-SHAPED COTYLEDON 3 isoform X1 | ||||
| Refseq | XP_020535451.1 | 6e-95 | protein CUP-SHAPED COTYLEDON 3 isoform X1 | ||||
| Swissprot | Q9S851 | 2e-87 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
| TrEMBL | W9QWF7 | 5e-97 | W9QWF7_9ROSA; Protein CUP-SHAPED COTYLEDON 3 | ||||
| STRING | XP_010094524.1 | 8e-98 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP11237 | 33 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G76420.1 | 7e-90 | NAC family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo12G0038900 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




