PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo14G0047700

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

SBP

Protein Properties

Length: 117aa MW: 13475.4 Da PI: 10.4086

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo14G0047700	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	130.8	5e-41	4	78	2	76
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 Cq+++C+adl++ak+yhrrhkvCevhska++v+v+gl+qrfCqqCsrfhe+sefD++krsCr+rLa+hnerrrk Spipo14G0047700 4 CQADACAADLATAKRYHRRHKVCEVHSKAAAVVVAGLRQRFCQQCSRFHEISEFDDAKRSCRKRLAGHNERRRKI 78 *************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51141	31.599	1	78	IPR004333	Transcription factor, SBP-box
Gene3D	G3DSA:4.10.1100.10	4.8E-33	2	65	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	5.23E-38	2	81	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.6E-32	4	77	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MPFCQADACA ADLATAKRYH RRHKVCEVHS KAAAVVVAGL RQRFCQQCSR FHEISEFDDA 60 KRSCRKRLAG HNERRRKICH EIEGERGSNL CRPADQHRRM KISFSDSSTC KRFQVR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	6e-36	1	77	8	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00359	DAP	Transfer from AT3G15270	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009392815.1	6e-50	PREDICTED: squamosa promoter-binding-like protein 3
Swissprot	Q9S758	2e-37	SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBL	M0RY52	1e-48	M0RY52_MUSAM; Uncharacterized protein
STRING	GSMUA_Achr1P08440_001	2e-49	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP8524	32	48

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G15270.1	5e-34	squamosa promoter binding protein-like 5

Link Out ? help Back to Top
Phytozome	Spipo14G0047700

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]