![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo16G0056400 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 136aa MW: 15057.4 Da PI: 9.8732 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 146.1 | 1.3e-45 | 22 | 131 | 1 | 110 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94
s++k+kaal v +v+p+f+ +dsgn ++k++G++ll++++a+++rkyd ek+q fals+tev+ l++l+++esceffhdp++k+s+eG+v+k+l
Spipo16G0056400 22 SIFKGKAALIVSPVLPKFSMMDSGNSVVKKKGSVLLKFMPAVGTRKYDPEKRQLFALSPTEVGCLISLGPEESCEFFHDPSMKSSQEGEVKKSL 115
79******************************************************************************************** PP
Whirly 95 kvePlpdGsGlfvnls 110
v P ++ G+f+ ls
Spipo16G0056400 116 TVSPTSNDGGYFFTLS 131
*************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.2E-46 | 13 | 132 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 2.12E-42 | 16 | 132 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 3.3E-43 | 23 | 131 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
VSEWIFNLGA QSRWRRTFAD FSIFKGKAAL IVSPVLPKFS MMDSGNSVVK KKGSVLLKFM 60 PAVGTRKYDP EKRQLFALSP TEVGCLISLG PEESCEFFHD PSMKSSQEGE VKKSLTVSPT 120 SNDGGYFFTL SKHPIS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4kop_A | 8e-48 | 16 | 131 | 10 | 125 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_B | 8e-48 | 16 | 131 | 10 | 125 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_C | 8e-48 | 16 | 131 | 10 | 125 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_D | 8e-48 | 16 | 131 | 10 | 125 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008803798.1 | 4e-58 | single-stranded DNA-binding protein WHY2, mitochondrial-like | ||||
| Swissprot | Q8VYF7 | 6e-47 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A1D1ZK83 | 2e-60 | A0A1D1ZK83_9ARAE; Anthranilate synthase component I-2, chloroplastic | ||||
| STRING | XP_008803798.1 | 2e-57 | (Phoenix dactylifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3012 | 38 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 3e-42 | WHIRLY 2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo16G0056400 |




