PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo20G0021100

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

MIKC_MADS

Protein Properties

Length: 187aa MW: 21565 Da PI: 9.5823

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo20G0021100	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	73.2	2.1e-23	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n++ rqvtfskRr ++KKAeE +L dae +i+fsstgklyeyss Spipo20G0021100 10 KIDNTTTRQVTFSKRRRSLFKKAEEFAILSDAEMGLIVFSSTGKLYEYSS 59 69**********************************************96 PP
2	K-box	16.5	3.5e-07	102	147	24	69
K-box 24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 L+k++ + ++R+l+ +d+++L+l+eLq++e++Le l ++ ++K Spipo20G0021100 102 LRKKVLESTLQLRQLKADDMGRLTLEELQNMEKALEAILCQVLKTK 147 455544444678************************9998887666 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.3E-31	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.731	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.08E-33	2	77	No hit	No description
SuperFamily	SSF55455	7.85E-27	2	83	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-22	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.2E-21	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-22	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.6E-22	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 187 aa Download sequence Send to blast
MGREKTNIRK IDNTTTRQVT FSKRRRSLFK KAEEFAILSD AEMGLIVFSS TGKLYEYSSN 60 SVKETIERHN HHSRVALKLV PPSLELQFFV TSQFQEKIRE SLRKKVLEST LQLRQLKADD 120 MGRLTLEELQ NMEKALEAIL CQVLKTKILL NSDIYFPSSY AFTCLYAEDM KFFPLSNYCN 180 LISSGM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-13	1	80	1	85	MEF2C
5f28_B	2e-13	1	80	1	85	MEF2C
5f28_C	2e-13	1	80	1	85	MEF2C
5f28_D	2e-13	1	80	1	85	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269\|PubMed:16679456, ECO:0000269\|PubMed:18694458, ECO:0000269\|PubMed:19656343, ECO:0000269\|PubMed:25132385}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17428825, ECO:0000269\|PubMed:18694458}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026388718.1	9e-47	MADS-box protein JOINTLESS-like
Refseq	XP_026388719.1	9e-47	MADS-box protein JOINTLESS-like
Refseq	XP_026455805.1	8e-47	MADS-box protein JOINTLESS-like
Refseq	XP_026455806.1	8e-47	MADS-box protein JOINTLESS-like
Swissprot	Q9FVC1	1e-43	SVP_ARATH; MADS-box protein SVP
TrEMBL	A0A1D1YHQ0	6e-49	A0A1D1YHQ0_9ARAE; MADS-box protein SVP
TrEMBL	A0A1D1Z0G2	6e-49	A0A1D1Z0G2_9ARAE; MADS-box protein SVP
STRING	XP_010277487.1	4e-46	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1221	36	97

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22540.1	6e-46	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Spipo20G0021100

Publications ? help Back to Top
Ramamoorthy R,Phua EE,Lim SH,Tan HT,Kumar PP Identification and characterization of RcMADS1, an AGL24 ortholog from the holoparasitic plant Rafflesia cantleyi Solms-Laubach (Rafflesiaceae). PLoS ONE, 2013. 8(6): p. e67243 [PMID:23840638] Jaudal M, et al. Overexpression of Medicago SVP genes causes floral defects and delayed flowering in Arabidopsis but only affects floral development in Medicago. J. Exp. Bot., 2014. 65(2): p. 429-42 [PMID:24249713] Müller-Xing R,Clarenz O,Pokorny L,Goodrich J,Schubert D Polycomb-Group Proteins and FLOWERING LOCUS T Maintain Commitment to Flowering in Arabidopsis thaliana. Plant Cell, 2014. 26(6): p. 2457-2471 [PMID:24920331] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Chen Z, et al. Overexpression of AtAP1M3 regulates flowering time and floral development in Arabidopsis and effects key flowering-related genes in poplar. Transgenic Res., 2015. 24(4): p. 705-15 [PMID:25820621] Wells CE,Vendramin E,Jimenez Tarodo S,Verde I,Bielenberg DG A genome-wide analysis of MADS-box genes in peach [Prunus persica (L.) Batsch]. BMC Plant Biol., 2015. 15: p. 41 [PMID:25848674] Müller-Xing R,Schubert D,Goodrich J Non-inductive conditions expose the cryptic bract of flower phytomeres in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(4): p. e1010868 [PMID:25924005] Marín-González E, et al. SHORT VEGETATIVE PHASE Up-Regulates TEMPRANILLO2 Floral Repressor at Low Ambient Temperatures. Plant Physiol., 2015. 169(2): p. 1214-24 [PMID:26243615] Bechtold U, et al. Time-Series Transcriptomics Reveals That AGAMOUS-LIKE22 Affects Primary Metabolism and Developmental Processes in Drought-Stressed Arabidopsis. Plant Cell, 2016. 28(2): p. 345-66 [PMID:26842464] Fernández V,Takahashi Y,Le Gourrierec J,Coupland G Photoperiodic and thermosensory pathways interact through CONSTANS to promote flowering at high temperature under short days. Plant J., 2016. 86(5): p. 426-40 [PMID:27117775] Wilson DC,Kempthorne CJ,Carella P,Liscombe DK,Cameron RK Age-Related Resistance in Arabidopsis thaliana Involves the MADS-Domain Transcription Factor SHORT VEGETATIVE PHASE and Direct Action of Salicylic Acid on Pseudomonas syringae. Mol. Plant Microbe Interact., 2017. 30(11): p. 919-929 [PMID:28812948] Zou YP, et al. Adaptation of Arabidopsis thaliana to the Yangtze River basin. Genome Biol., 2017. 18(1): p. 239 [PMID:29284515] Richter R, et al. Floral regulators FLC and SOC1 directly regulate expression of the B3-type transcription factor TARGET OF FLC AND SVP 1 at the Arabidopsis shoot apex via antagonistic chromatin modifications. PLoS Genet., 2019. 15(4): p. e1008065 [PMID:30946745]