![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Spipo21G0015100 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 12429.3 Da PI: 10.4677 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.2 | 7e-33 | 28 | 86 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
Spipo21G0015100 28 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLAEDPRMVITTYEGRHIHS 86
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.5E-34 | 13 | 86 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.92E-29 | 20 | 87 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.241 | 23 | 88 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.2E-36 | 28 | 87 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.2E-25 | 29 | 85 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
| GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MNTKKAKAKR KLREPRFCFK TMSDVDVLDD GYKWRKYGQK VVKNTQHPRS YYRCTQDKCR 60 VKKRVERLAE DPRMVITTYE GRHIHSPSRD GDEPKTPSQI SFFC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-27 | 19 | 85 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-27 | 19 | 85 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108755 | 3e-90 | AK108755.1 Oryza sativa Japonica Group cDNA clone:002-150-F11, full insert sequence. | |||
| GenBank | AY341853 | 3e-90 | AY341853.1 Oryza sativa (japonica cultivar-group) WRKY12 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010268590.1 | 2e-60 | PREDICTED: probable WRKY transcription factor 13 | ||||
| Swissprot | Q9SVB7 | 5e-53 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | A0A1U8AYR9 | 4e-59 | A0A1U8AYR9_NELNU; probable WRKY transcription factor 13 | ||||
| STRING | XP_010268590.1 | 7e-60 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 2e-55 | WRKY DNA-binding protein 13 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Spipo21G0015100 |




