PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Spipo22G0021800

Organism

Spirodela polyrhiza

Taxonomic ID

29656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela

Family

WOX

Protein Properties

Length: 112aa MW: 13026 Da PI: 10.1576

Description

WOX family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Spipo22G0021800	genome	MIPS/IBIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	46.9	4.7e-15	28	85	2	54
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRak 54 r+R+t+++eq+ +Le+ F++ +p ++e ++ k l + +++V++WFqNrR + Spipo22G0021800 28 RTRWTPKPEQILILESIFNSgMVNPPKDETVKIRKLLqnfgPVGDANVFYWFQNRRSR 85 89***************99************99999************98 PP
2	Wus_type_Homeobox	102	4.1e-33	27	86	2	61
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRe 61 +rtRWtP+peQi iLe++++sG+++P+k+e+ +i++ L+++G ++d+NVfyWFQNr++R+ Spipo22G0021800 27 VRTRWTPKPEQILILESIFNSGMVNPPKDETVKIRKLLQNFGPVGDANVFYWFQNRRSRS 86 689********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.0E-6	7	86	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.03E-12	22	88	IPR009057	Homeodomain-like
PROSITE profile	PS50071	10.025	24	89	IPR001356	Homeobox domain
SMART	SM00389	4.5E-4	26	93	IPR001356	Homeobox domain
CDD	cd00086	1.59E-5	28	88	No hit	No description
Pfam	PF00046	1.3E-12	28	85	IPR001356	Homeobox domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 112 aa Download sequence Send to blast
MEERTQETTV SRRGSTVDRG IPTTEPVRTR WTPKPEQILI LESIFNSGMV NPPKDETVKI 60 RKLLQNFGPV GDANVFYWFQ NRRSRSPRIL VDRYIIKCIV DELLWWAAFS M*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in crown root development (PubMed:26307379, PubMed:29740464). Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system (PubMed:26307379, PubMed:29740464). Regulates the expression of genes required for crown root development, and hormone-responsive genes involved in cytokinin signaling (e.g. RR1, RR2, RR3 and RR4), and auxin signaling (e.g. IAA5, IAA11, IAA23 and IAA31) (PubMed:26307379). Functions dowstream of the auxin biosynthetic genes YUCCA1 in the promotion of crown root development (PubMed:29740464). {ECO:0000269\|PubMed:26307379, ECO:0000269\|PubMed:29740464}.
UniProt	Transcription factor which may be involved in developmental processes. Promotes the development of crown roots (both initiation and elongation), main components of the fibrous root system, by regulating the expression of genes required for crown root development and hormone-responsive genes involved in cytokinin (e.g. RR1, RR2, RR3 and RR4) and auxin (e.g. IAA5, IAA11, IAA23 and IAA31) signaling. {ECO:0000250\|UniProtKB:Q0D3I7}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012857238.1	2e-34	PREDICTED: WUSCHEL-related homeobox 11-like isoform X1
Refseq	XP_012857239.1	2e-34	PREDICTED: WUSCHEL-related homeobox 11-like isoform X2
Swissprot	B8B644	1e-32	WOX11_ORYSI; WUSCHEL-related homeobox 11
Swissprot	Q0D3I7	1e-32	WOX11_ORYSJ; WUSCHEL-related homeobox 11
TrEMBL	A0A022PWX3	2e-33	A0A022PWX3_ERYGU; Uncharacterized protein (Fragment)
TrEMBL	A0A453I6E4	8e-34	A0A453I6E4_AEGTS; Uncharacterized protein
STRING	GSMUA_Achr6P15910_001	1e-32	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1078	37	109

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17810.2	2e-34	WUSCHEL related homeobox 12

Link Out ? help Back to Top
Phytozome	Spipo22G0021800

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Zhao Y, et al. The Interaction between Rice ERF3 and WOX11 Promotes Crown Root Development by Regulating Gene Expression Involved in Cytokinin Signaling. Plant Cell, 2015. 27(9): p. 2469-83 [PMID:26307379] Zhang T, et al. The YUCCA-Auxin-WOX11 Module Controls Crown Root Development in Rice. Front Plant Sci, 2018. 9: p. 523 [PMID:29740464]